KEGG   Pyrobaculum ferrireducens: P186_0586Help
Entry
P186_0586         CDS       T01670                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00300  Lysine biosynthesis
pyr01100  Metabolic pathways
pyr01120  Microbial metabolism in diverse environments
pyr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    P186_0586
Enzymes [BR:pyr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     P186_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer FAM110_C
Motif
Other DBs
NCBI-ProteinID: AET32038
UniProt: G7VHD5
Position
510561..511760
Genome map
AA seq 399 aa AA seqDB search
MESRAVSILSKLISIPTVNPPGEKYAELVEYAEKFFKSLGLETEIVEVPKAEVSKRCAEC
ADYPRLILLARSGEPKIHFNGHYDVVPPGPLESWRVTKPFEPLYRDGRLYGRGAVDMKGG
LTSIMLAVEKAVSAGLKNFEISFVPDEETGGETGAGYLAKSGKITAPWVVIAEGSGEDNI
WIGHRGLVWFIVEVYGKQAHGSTPWQGLNAFEGAAYIAYRLQEYAKLIAARSSKYEYDDP
RGATPTVTIGGEVRGSVKTNVVPGYFAFSVDRRVIPEEDLEAVKKEFIDFVERVAKELPH
RVEVKVTNVSEAALVEPSHPLIEALSASVEEVIGRKPRRTVCIGGLDARFFIKQGIPAAT
YGPGPIGLAHAPDEYVEVRQVLNVAEAYYRLIKRLNAKT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaagagccgtatctatcctaagcaagctcatatcaatacccacagtcaaccca
cccggcgagaaatacgcagagctggttgagtacgccgagaagtttttcaaatccctcgga
ctagaaacagaaatcgtagaggttcctaaggcggaggtgtcaaaacgctgtgcggaatgc
gccgactatccgaggctgattctactggcgagaagcggagagccaaaaatacacttcaac
ggccactacgacgtagtgccgccgggcccactggagagctggagagtaacaaaacccttc
gagcctctctaccgagacggaaggctctacggaagaggcgcggtagatatgaaaggcggg
ctgacctcaattatgctggccgtggagaaggccgtgtcggctgggctgaaaaacttcgag
atatcattcgtccctgatgaggagacaggcggcgaaaccggcgccggctacttggcgaag
tcgggcaaaatcacggcgccgtgggtcgtaatcgccgagggctccggcgaggataacata
tggattggccacaggggattggtgtggtttatagtcgaggtgtatggaaaacaggcacac
ggctctaccccatggcaagggctgaacgccttcgagggggcggcgtacatcgcctacaga
ctacaggaatacgccaagttgatagccgccaggtctagtaaatatgaatacgacgacccg
aggggcgccacccccaccgtgacaataggaggagaggttcgcggctccgtcaagaccaac
gtggtgcccggatacttcgccttctccgtagaccgcagagtgataccagaggaggattta
gaagcggtgaaaaaagaatttatagatttcgtcgagcgcgtggccaaggaactcccccac
agagtcgaggtgaaggtgaccaacgtctccgaggccgcgttggtggagcccagccaccca
ctcatcgaggccctctcggcgtctgtagaggaggtaatcgggaggaagcccaggaggacg
gtctgcatcggcgggctagacgcgaggtttttcataaagcaggggattcccgccgcgacc
tacgggccgggccccataggcctcgcccacgccccagacgaatatgtggaggtgcgccag
gtgctaaacgtggccgaggcgtactacaggctaataaagcggctgaacgccaagacctag

DBGET integrated database retrieval system