KEGG   Pyrobaculum ferrireducens: P186_1327Help
Entry
P186_1327         CDS       T01670                                 

Definition
(GenBank) 2-ketoacid ferredoxin oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00010  Glycolysis / Gluconeogenesis
pyr00020  Citrate cycle (TCA cycle)
pyr00620  Pyruvate metabolism
pyr00633  Nitrotoluene degradation
pyr00640  Propanoate metabolism
pyr00650  Butanoate metabolism
pyr00680  Methane metabolism
pyr00720  Carbon fixation pathways in prokaryotes
pyr01100  Metabolic pathways
pyr01120  Microbial metabolism in diverse environments
pyr01130  Biosynthesis of antibiotics
pyr01200  Carbon metabolism
Module
pyr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pyr_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1327
   00020 Citrate cycle (TCA cycle)
    P186_1327
   00620 Pyruvate metabolism
    P186_1327
   00640 Propanoate metabolism
    P186_1327
   00650 Butanoate metabolism
    P186_1327
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1327
   00680 Methane metabolism
    P186_1327
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    P186_1327
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     P186_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_9 Fer4_16 Fer4_10 Fer4_2 Fer4_17 Fer4_13 Fer4_8 Fer4_15 Fer4_4 Fer4_22 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AET32756
UniProt: G7VDH1
Position
1109300..1109572
Genome map
AA seq 90 aa AA seqDB search
MECVKSIVLPISKPAPASAGVTGTWRTYRPVVNLEKCIDCGLCWLYCPESVIDWEKGEKV
KIDYTYCKGCGICAEVCPVKAIDMEPEEGV
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcgttaagtctattgtgttgcctatctcaaaacccgcgccggcgtccgccggc
gtcaccggcacgtggcgcacctatagaccagtggtgaatcttgagaagtgtatagactgc
ggactatgttggctctactgtccagagtctgtaatcgactgggaaaagggcgagaaggtg
aaaattgactacacctactgcaagggctgtggcatctgtgcagaggtctgcccagtaaag
gctatagatatggagccagaggagggggtatga

DBGET integrated database retrieval system