KEGG   Pyrobaculum ferrireducens: P186_1664Help
Entry
P186_1664         CDS       T01670                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00010  Glycolysis / Gluconeogenesis
pyr00620  Pyruvate metabolism
pyr00640  Propanoate metabolism
pyr00680  Methane metabolism
pyr00720  Carbon fixation pathways in prokaryotes
pyr01100  Metabolic pathways
pyr01110  Biosynthesis of secondary metabolites
pyr01120  Microbial metabolism in diverse environments
pyr01130  Biosynthesis of antibiotics
pyr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1664
   00620 Pyruvate metabolism
    P186_1664
   00640 Propanoate metabolism
    P186_1664
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1664
   00680 Methane metabolism
    P186_1664
Enzymes [BR:pyr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P186_1664
Lipid biosynthesis proteins [BR:pyr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P186_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AET33080
UniProt: G7VGI0
Position
1406748..1408703
Genome map
AA seq 651 aa AA seqDB search
MEHVYSKYSVYKRWLEDQEGYWREFLEKTSNLIYWAKKPDQIFEWNPPQPFRWFTGGYTN
AGYSAVDYKVGRFGDKTAYIYVNPELGLERRVTYGELYNLVCRFSAAMRAAGVGRGDSVL
IYMPNTVEAVAAILAAARIGAVSSTVFAGFSPKAVADRVELVEPKIIFTQDYSVRRGRRV
PLKENIDEALKISPWRPRMVVVRRSLMEEKEPPMDRGRDMWLEEFLEMGKAGDCSPLFVE
SNEPLFVLPTSGTTAKPKPVVHVHGGYQVWIIHGALLVYGLSSDDVIFNTSDIGWVVGQS
YIVFAPTILGATSVLFDGVIDHPRPDVFWEVVEKYRPTLIWTSPTAARMLMRLGAHHARR
HDLSSVKRVVTAGEVLNPEVWRWLYEEAFQKRVPVIDHWWQTELSGPAIGYYHALVKDMP
QGLEFMQIKPGSAGVPIPGVEVEVVDEKGNPLPPGQKGTLVIKKPFPGMTPTLWKDHRRY
MADYWERFEGKTVYYTGDAAYVDEDGYVWFGGRADEVIKIAGHRIGTIEVESALLTHPAV
AEAAVVGVPDPIRGEAIAAFVVLRPGWSPSEALRRELIEHVRKTFGPIAVFAGMEFVNML
PRTRSGKIMRRVMKRLWTGEPLGDLSTIEDEASVDEVREAVSRLKVLKIEE
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgtatatagtaaatacagtgtatataaaagatggttagaagatcaagaggga
tactggagagagtttctagagaagacctctaacttgatatactgggcaaagaagccagat
cagatatttgagtggaatccgccccagccgtttagatggttcactggaggctacaccaat
gccggctacagcgccgtggattacaaagtgggtagattcggcgacaagactgcatatatc
tacgtaaaccccgagcttggtctagagaggagggtaacctacggcgagctgtacaaccta
gtgtgtagattcagcgcggccatgagggcggcgggggtggggaggggggactccgtcctt
atctacatgccaaacaccgtggaggcggtggcggctattctggcggcggctaggataggg
gcggtgtccagcacggtgttcgccggcttctcgcctaaggccgtggcggacagggtcgag
cttgtggagcccaagattatctttacacaagactactctgtgaggagggggcggagggtt
ccgctgaaggagaatatagacgaggcgctgaagatatcgccgtggaggccccgtatggtg
gtggtgaggaggagcctaatggaggagaaggagccgcccatggataggggccgcgacatg
tggctggaggagtttctcgaaatggggaaggccggcgactgctcgcctctgtttgtagag
tctaacgagcctctattcgtcctgccgacgtcgggcaccaccgccaaaccaaagccggtt
gtccacgtccacggcggctaccaggtgtggattatccacggcgccttgctcgtatacggc
ctgtccagcgacgacgtgatattcaacacaagcgacataggctgggtggtggggcagagc
tacatagtcttcgcccctaccatattgggcgcgacctcagtcttattcgacggcgtcata
gaccaccccaggccagacgtgttttgggaggtggttgagaagtaccgccccaccttgata
tggacctcgcccacggccgccaggatgttgatgaggctgggggcccaccacgccaggagg
cacgacctctccagcgtcaagcgggttgtgaccgccggcgaggtgcttaacccagaggtg
tggaggtggctgtatgaggaggccttccagaagcgggtcccagtaattgaccactggtgg
cagaccgagctcagcggccccgccatcggctactaccacgcccttgtgaaagacatgccc
caaggcctggagtttatgcaaatcaagccgggctccgccggcgtgccgatccccggcgtg
gaggtggaggtggtggacgagaagggcaacccactaccgcccgggcagaaaggcaccttg
gtaataaagaagccgttccccggaatgacccccactctgtggaaagatcacaggaggtat
atggccgactactgggagcgctttgaggggaagacggtttactacaccggcgacgccgcg
tatgtagacgaggacggctacgtgtggttcggcgggagggcagacgaggtgataaaaatc
gccgggcaccgcataggaacaatagaggtggaatccgccctcctcacgcaccccgccgtg
gccgaggcggctgtggtcggcgtgcccgacccaataaggggagaggcgatcgccgccttc
gtcgtgctccgcccaggctggagccccagcgaggctttgagaagggagttgatagaacat
gtgaggaagaccttcggccccatcgcggtgttcgccggcatggagttcgtcaatatgctt
cccagaactcggtctggaaaaatcatgcgtagagttatgaagcggctctggaccggggag
ccgctcggcgacttgtctacaatagaagacgaggcgtctgtagacgaggtgagagaggct
gtgtcgaggctaaaagttctgaaaatagaagagtaa

DBGET integrated database retrieval system