KEGG   Pyrobaculum ferrireducens: P186_1931Help
Entry
P186_1931         CDS       T01670                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00030  Pentose phosphate pathway
pyr01100  Metabolic pathways
pyr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P186_1931
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     P186_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N Shikimate_DH FAD_binding_3 Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AET33333
UniProt: G7VHX3
Position
complement(1617841..1618887)
Genome map
AA seq 348 aa AA seqDB search
MKAVTAVPGVPESLRLREVPKPVPKAGEALLRPLAVGVCGTDKEIIEGRYGKAPEGSDFL
ILGHEALAEVADVGAGVDNVSPGDVVVPTVRRPLNCDLPVDYCPFGKYLEHGIWGLHGHA
AEYSISDARYLVKVPPEVVDVAVLTEPLSVVEKGVELGLNLYQARLSRLPQRALVLGAGP
IGLLAAMLLRLRGLAVTVTATRPPDSLKAKLAQQIGAVYVDAAHDEISGKFDLVIEATGS
PQVALEGLERLESGGVEVLLGVYPRGGTLNDVGALLTDAVLNNKLVVGSVNAGIRHFQMA
LQHLKEAKERYGDWPRRLITKEATLENYAEAYHWTHDDIKTVLVMTPK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtcacggcggtgcccggggtgccggagtcgctgaggctgagggaggtgccg
aagccggtgccaaaggccggggaggccctcctgcgcccgcttgcagtgggggtgtgcggg
accgataaggagattatcgaggggaggtacggcaaggcgccggagggtagcgacttctta
attctcggccacgaggcgctggcggaggtagccgacgtgggggccggggtggacaacgtc
tcgcctggcgacgtcgtggtgccgacggtgaggcgccccctaaactgcgacttgccggtg
gactactgcccctttggaaaatacctagagcacggcatatggggcctccacggccacgcc
gcggagtactccatctcagatgcaaggtatctagtgaaagtcccgcctgaggtggttgac
gtggctgtgctcacggagccgctgtcggtggtggagaagggggtggagctggggctgaac
ctctaccaggcgaggcttagccgactgcctcagagggctttggtgctcggcgcggggccc
atcggacttttggcggcgatgttgctaaggctccgcggcctagcggtgaccgtaaccgcg
acgcgcccgcctgatagcttgaaggcgaagctggctcagcagattggggctgtgtacgtc
gatgcggctcacgacgagatctccggcaagttcgacctagtgattgaggccactggctcg
ccgcaggtggcgctggagggcttggagaggcttgagtcaggcggcgtcgaggtgttgctg
ggggtatacccaagaggcggcactttaaacgacgtcggtgccctcctcacagacgctgtg
cttaacaacaagctggtagtcggctccgtaaacgcggggatacgccacttccaaatggcc
ctccagcatctaaaagaggccaaggagaggtacggcgactggccgaggaggctgatcacc
aaggaggccaccctcgagaactacgcagaggcttaccactggacgcacgacgacataaaa
acagtcttggtaatgacgccgaagtaa

DBGET integrated database retrieval system