KEGG   Pyrobaculum ferrireducens: P186_2447Help
Entry
P186_2447         CDS       T01670                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase (aor)
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00010  Glycolysis / Gluconeogenesis
pyr01100  Metabolic pathways
pyr01120  Microbial metabolism in diverse environments
pyr01200  Carbon metabolism
pyr01230  Biosynthesis of amino acids
Module
pyr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_2447
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     P186_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: AET33833
UniProt: G7VCM8
Position
2037674..2039659
Genome map
AA seq 661 aa AA seqDB search
MIVLEINVESGEVRRRELESTGPLDLALAIHRERETWRLDPLAPEAPVVFGMGPFVGGRL
HGVHRLIFVFKSPQTKTLHVSALGGAAYKAMGMGAHAVAIVGRAPRPTALLIAGGEVKFA
EAEPGDAYEVAKKLYAAHREFFVENDARVLAVGPAAFTTYNGAVVSIDIDAKRGEFRLGA
EDFAARGGPGTALAQGHNVVAVAVGGLKKPLYQKVADVEAINQIFKTKMGKPYLEVLNEK
TVKYRYDPKMGTGGTFGVNYPHYRDLLPLFGYKSIYMTKEERVKHADLVLELFWKPFQVE
VFEKARSWYNCGEPCPVVCKKVWRGKKVDYESFHAVGPFIGNYIFQEAVPLVDKIDRLGL
DAIETGHLVAWLFDAVHAGLLKPEEVGLSDVPAFDPAAFKPVEDSRKNARLAGELIEGFV
NNSTEVLTLVARYGIRKAARELERRYPDRVRAAGHRFRDLAVYAAYGTEGYMTPNFYWAP
GLIGPMYIQGRYWTNYNPTFMPPEDFAKSSYERAVAEAYIDNAGICRFHRGWAEPVLKEL
YSLAGLKPPTPQLYRDIAYYAKLAGAEPMPWESKRARDPVLKELYSLAGLKPPTPQLYRD
IAYYAKLAGAEPMPWESKRARDLVSTLARELGAKEWKFEDYDDYYEWWVRYKEALDKLIF
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtacttgagataaacgtagaaagcggtgaggtgaggaggcgggagttggagtcc
acaggcccgctggacctggcgctcgccatacacagagaacgcgagacgtggcgcctagat
cccctggcgccggaggctccggtggtcttcggcatggggcccttcgtcggcgggaggcta
cacggagtgcacagattgatatttgtcttcaaaagcccccagaccaagacgctacacgta
tccgccctcggaggggcggcttacaaagccatgggaatgggggcccacgcggttgccata
gtggggagggccccgaggcccacagccctcctgatcgcaggcggcgaggtgaagttcgcc
gaggcggagccgggggatgcatatgaagtggccaaaaagctctacgccgcccacagagaa
tttttcgtagaaaacgacgcgagggtactggcggtgggccccgcggctttcaccacgtac
aacggcgccgtggtctccatagatatagacgcgaaaaggggagagtttaggctaggcgcc
gaggacttcgccgctagaggaggcccgggcaccgccctggcccaggggcacaacgtcgtt
gctgtcgccgtggggggcttgaaaaagcctctctaccaaaaggtcgcagacgtcgaagca
ataaaccagatattcaagacgaaaatgggcaagccctacctagaggtgctcaacgaaaag
actgtgaagtacaggtacgaccccaagatggggacggggggcaccttcggggtaaactac
ccgcactaccgcgacctgctacccctcttcggctacaaatccatctacatgaccaaggag
gagagggtaaagcacgcagatctggtgctggagctcttctggaagcccttccaggttgag
gtgtttgaaaaggcgaggagctggtacaattgcggagagccctgccccgtggtttgtaaa
aaagtgtggcggggcaagaaggtggactacgagtccttccacgccgtggggcctttcata
ggcaactacatattccaggaggcggtgccgctggtggacaaaatcgaccgcctaggccta
gacgccatagagacaggccacctagtggcgtggctcttcgacgctgtgcacgccggcctg
ctgaagccggaggaggtggggctgagcgacgtgccggccttcgaccccgccgccttcaag
cctgtggaggactctagaaaaaacgcaaggcttgcaggcgagctgatagagggctttgtg
aacaactcaaccgaggtcctcaccctcgtggctagatacggcattagaaaagccgcgcgg
gagctggagaggcgctaccccgacagagtgagggccgccggtcatagatttagagacctc
gccgtatacgccgcgtacggcacagaggggtacatgacgccgaacttctactgggccccc
ggcttgataggacccatgtacatacaggggcgttactggacaaactacaaccccaccttc
atgccgcctgaagacttcgccaagtcatcctacgaacgcgccgtcgcagaggcctacata
gacaacgcaggtatctgcaggttccacagaggctgggccgagccggtgctcaaggagctc
tactccctagccggcttaaaaccccccaccccccagctctaccgcgacatagcctactac
gccaagctagccggcgcggagccgatgccttgggagagcaaaagagccagagacccggtg
ctcaaggagctctactccctagccggcttaaaaccccccaccccccagctctaccgcgac
atagcctactacgccaagctagccggcgcggagccgatgccttgggagagcaaaagagcc
agagacctagtctccaccctcgcccgcgaactcggcgcaaaagagtggaaattcgaagac
tacgacgactactacgagtggtgggttaggtacaaagaagccctagacaaactgatattc
agctag

DBGET integrated database retrieval system