KEGG   Pyrococcus sp. ST04: Py04_0252Help
Entry
Py04_0252         CDS       T02124                                 

Definition
(GenBank) putative 43 kDa subunit bacteriochlorophyll synthase-like protein
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pys00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Py04_0252
Enzymes [BR:pys01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Py04_0252
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Py04_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl FAD_oxidored DAO FAD_binding_2 Trp_halogenase HI0933_like Pyr_redox_2 NAD_binding_8 Thi4 GIDA 3HCDH_N GDI DUF596 SE
Motif
Other DBs
NCBI-ProteinID: AFK21854
UniProt: I3RC94
Position
249732..250913
Genome map
AA seq 393 aa AA seqDB search
MRYDVIVVGSGVAGPIVARNVAKAGFSVLLVDKKPAIGTPKQCAEGINVNVFKEFDIPYD
KRFINREIYGARIYSPSGYTAELRYKEVSGVILERKVFDKMLAYYAAKEGAEVLARTEVV
DVLKRNGKIVGVKAKHEGEPIEIEAEIIVAADGVESTVARKAGINTYAPPHEFDSAYEYE
MLIEGYDPDLIHLWFGNEIAPRGYVWVFPKDEDRANVGIGINSDNEKTAKYYLDKWLKEN
NIPRNRILEINVGLVPVGGFVKELVKDNVLVVGDAARQVNPVHGGGMYEAMKASTIASKW
IVRALEEENVELLKNYTKEWWETEGPKMEKLLRLRRAMEKLTDEDIDVFVQLLGGTDLEK
LASGNYFEVVKALMKHPKVLMSKRRLEILKALV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgatgtcattgtagttggttctggggttgcgggcccaatagttgctagaaat
gttgctaaagctggtttttctgttctgctggttgataaaaaacctgcaattgggacacca
aaacagtgcgccgagggaattaatgttaacgtcttcaaggaattcgacattccctatgat
aaaaggttcatcaacagagaaatctatggggccaggatatactctccaagtggatatact
gccgagctgaggtacaaggaagttagtggggttattcttgaaaggaaagtattcgacaaa
atgctggcatattatgccgctaaggaaggggcagaggtactagctagaactgaagtcgtg
gatgttctaaaaaggaatggtaaaatagtgggagtcaaggcaaagcacgaaggagaaccc
atagagattgaggctgaaattatagtggctgcagatggtgttgaaagtactgtggcaagg
aaagcaggaataaacacgtatgctcctcctcatgagtttgattctgcttacgaatatgag
atgttgatagaggggtatgatcccgacttaatccatttatggtttgggaatgaaatagct
cctcgcggttacgtatgggtattcccaaaggatgaggacagagcaaatgttggaattggg
ataaattcagacaacgagaagacggccaaatattacctcgataagtggctcaaggagaac
aatatccccaggaacaggatccttgaaattaacgttggtttagttcccgtggggggattc
gttaaggagttagtcaaggacaatgttcttgtagtgggtgatgctgctaggcaagttaat
cccgttcacggtggaggaatgtacgaagccatgaaagcatcgacaattgcatccaaatgg
atcgttagagccctagaggaagagaatgttgagcttttaaagaactatacaaaagagtgg
tgggaaactgaaggtccaaagatggagaagttgcttaggttaagaagggctatggagaag
ctaactgatgaagacattgatgtatttgtacagctacttggtggtacggatcttgagaaa
cttgctagtggaaattactttgaagttgtgaaggccctaatgaagcatccaaaagtttta
atgagcaaaagaaggcttgaaatacttaaggctcttgtataa

DBGET integrated database retrieval system