KEGG   Pyrococcus sp. ST04: Py04_0858Help
Entry
Py04_0858         CDS       T02124                                 

Definition
(GenBank) phospho-sugar mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00010  Glycolysis / Gluconeogenesis
pys00030  Pentose phosphate pathway
pys00051  Fructose and mannose metabolism
pys00052  Galactose metabolism
pys00230  Purine metabolism
pys00500  Starch and sucrose metabolism
pys00520  Amino sugar and nucleotide sugar metabolism
pys00521  Streptomycin biosynthesis
pys01100  Metabolic pathways
pys01110  Biosynthesis of secondary metabolites
pys01120  Microbial metabolism in diverse environments
pys01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_0858
   00030 Pentose phosphate pathway
    Py04_0858
   00051 Fructose and mannose metabolism
    Py04_0858
   00052 Galactose metabolism
    Py04_0858
   00500 Starch and sucrose metabolism
    Py04_0858
   00520 Amino sugar and nucleotide sugar metabolism
    Py04_0858
  Nucleotide metabolism
   00230 Purine metabolism
    Py04_0858
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Py04_0858
Enzymes [BR:pys01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Py04_0858
    5.4.2.8  phosphomannomutase
     Py04_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFK22450
UniProt: I3RDZ0
Position
865539..866909
Genome map
AA seq 456 aa AA seqDB search
MGKLFGTFGVRGIANEKITPEFAMKIGMAFGTMLKREGRKKPVVVVGRDTRVSGEMLKNA
LISGLLSVGCDVIDVGIAPTPAVQWATKYFNADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAIVEELFFKEDFDRAKWYEIGEVRREDIIKPYIEAIKSKVDVEAIKKRRPFVVVD
TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLRGFMEIVKALGADFGV
AQDGDADRAVFIDEKGRFIQGDKTFALVADAVLRENGGGLLVTTVATSNLLDDIAKRNNA
KVLRTKVGDLIVARALLEHNGTIGGEENGGVIFPDHVLGRDGAMTVAKIVEIFAKSGKKF
SELIDELPEYYQIKTKRHVEGDRYKIVNKVAEMAKERGYTVDTTDGAKIIFEDGWVLVRA
SGTEPIIRIFSEAKSEEKAEEYLNLGLELLEKALEA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggggaagctctttggaacgtttggagtgagggggatagcaaacgaaaagataacccca
gaattcgccatgaagattgggatggcatttgggacaatgctaaaaagagagggaaggaaa
aagccggtagtggttgttggtagagatacaagagtcagtggggaaatgctcaaaaatgcc
ttgataagtggcctcctcagcgttggctgtgatgtaatagatgttggcatagctcccaca
ccggcagttcaatgggcaaccaaatatttcaacgcagacggtggagctgttatcacggcc
tctcataatcctccggagtacaacggaataaagcttttggaacctaatgggatggggctg
aagaaagagagggaagcaattgttgaggaactcttctttaaagaagacttcgatagggct
aagtggtatgaaattggagaagttagaagagaggacataataaagccctatatcgaggct
ataaagagcaaagtcgatgttgaagcgataaagaaaagaagaccctttgtggttgttgac
acgtctaacggtgctggaagcttgactctaccctatctgctcagagaacttggatgtaaa
gttgtgagcgttaacgctcacccagatggacatttcccagcaagaaatcctgaaccgaat
gaagaaaacttgagaggatttatggagatcgttaaggcgcttggagccgactttggagtg
gcccaggacggagatgcagatagggcagttttcattgatgaaaagggcaggtttatccaa
ggggataaaacatttgccttggttgcagatgctgttctcagagaaaatggagggggtctt
ctggtaactacagttgctacctctaaccttcttgacgacatagctaaaagaaacaatgcg
aaagttctcagaactaaggttggagatctaatcgttgcaagggctcttcttgagcacaac
gggaccataggaggtgaagaaaacggtggagtaatattcccagaccatgttcttggaagg
gatggagcaatgaccgtggcaaagatagttgagatattcgcaaagagcgggaagaagttc
agtgagcttatagatgagttgcctgaatattatcaaataaagaccaagaggcatgtagag
ggggacaggtacaaaattgtcaacaaagttgctgaaatggcaaaagagagaggttatact
gtagatactactgatggtgcaaagataatattcgaagatgggtgggttctggttagggca
agtggaactgagccaataataagaatattcagcgaagcaaagagcgaggaaaaggcggaa
gagtatctaaacttaggattagagcttcttgaaaaagccctagaggcctga

DBGET integrated database retrieval system