KEGG   Pyrococcus sp. ST04: Py04_1604Help
Entry
Py04_1604         CDS       T02124                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pys01100  Metabolic pathways
pys01110  Biosynthesis of secondary metabolites
pys01130  Biosynthesis of antibiotics
pys01230  Biosynthesis of amino acids
Module
pys_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Py04_1604
Enzymes [BR:pys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Py04_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: AFK23175
UniProt: I3RG15
Position
1578968..1579651
Genome map
AA seq 227 aa AA seqDB search
MVFGLSKAIRRSKKNAIIAELKLYSPKYGDLLRGRNPFDILRKYERAGAVGISYITDPKY
FRGSFEFFKKLCKETELPVLRKDFITSKEEIEKTAEAGGSAILLITRVLKEDIFEFVDYA
LEHGLDTLVEVHTTEELEIAVQTKSTMIGINNRDIGKLELDDGTVKLTELLAPKIPNKFI
KVSESGIATIEDLKIALKYADAALIGTALMKADDPEKLLKTFVEAKP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggtttttggactgagcaaagccataaggagaagtaaaaagaacgcaattatagccgag
ttgaaactctattctccaaagtatggagatctcttgagaggcaggaacccctttgacatt
ctaaggaagtatgaaagagcaggagcagttggcatatcctacataactgatcccaagtac
tttaggggaagttttgagttctttaaaaaactctgcaaagagaccgaacttccagttctc
agaaaagatttcataacgagtaaggaagaaatagaaaaaacagcagaggctggcggatct
gcaatactcctaataaccagagtattaaaagaggatatttttgagttcgtagattacgcc
ctagaacacgggctagatacattagtagaggttcatactacagaagaactcgagattgcc
gttcaaacaaaatcaacaatgatcggaataaacaacagggacatagggaagctagaactt
gacgatggaactgtaaaattaacagaactccttgcccccaaaatcccaaacaagttcatc
aaagtaagtgaaagcggaatagcaacaatagaggacctaaaaatagccctaaagtatgca
gacgccgcccttataggaacagcccttatgaaagcagatgatcccgaaaaactcctcaaa
acttttgtggaggcaaaaccatga

DBGET integrated database retrieval system