KEGG   Paracoccus zhejiangensis: CX676_04855Help
Entry
CX676_04855       CDS       T05233                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00670  One carbon pool by folate
pzh01100  Metabolic pathways
pzh01120  Microbial metabolism in diverse environments
pzh01200  Carbon metabolism
Module
pzh_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CX676_04855
Enzymes [BR:pzh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CX676_04855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AUH63575
UniProt: A0A2H5EW96
Position
complement(971124..972839)
Genome map
AA seq 571 aa AA seqDB search
MNEVIAAPRDAKPVAFKTDSEIANAAMKRPIQEIGAKLGIDAGDLLPYGHDKAKLSQRFI
NSVQDRPNGKLVLVTAINPTPAGEGKTTTTVGLGDGLNAIGKTACVCIREASLGPNFGMK
GGAAGGGYAQVIPMEDMNLHFTGDFHAITSAHNLLSAMIDNHIYWGNEQDIDLRRVVWRR
VVDMNDRALRQITCSLGGVANGFPRETGFDITVASEVMAILCLSRDLEDLQHRLGEMIVA
YRRDKSPVYCRDIKADGAMTVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIAT
TTALKLADYVVTEAGFGADLGAEKFFDIKCRKAGIAPDVAVIVATVRALKMNGGVAKADL
GPENVAAVKKGLVNLGRHIANVKSFGVPVIVAINHFVSDTDAEVQAVQDYARQNGVEAIL
CKHWADGSQGTLDLARKVVEIAEKGAAEFAPLYPDEMPLFAKIETIAKRIYHADEVIADS
KIRAQLKDWEEQGYGHLPICMAKTQYSFTTDPTRRGAPTGHSVPIREVRLAAGAGFIVAI
CGEVMTMPGLPRTPAAEVIGLNPSGEVQGLF
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggttattgccgctccgcgcgacgccaagccggtcgcattcaagaccgacagc
gagatcgccaacgccgccatgaagcgcccgatccaggagatcggggccaagctcgggatc
gatgccggcgatctgctgccttacggccatgacaaggccaagctcagccagcgcttcatc
aactcggtccaggatcgccccaatggcaagctggtgctggtcaccgcgatcaacccgacc
ccggcgggcgagggcaagaccacgaccacggtgggtctgggcgacgggctgaatgccatc
ggcaagaccgcctgcgtctgcatccgcgaggcctcgcttggcccgaacttcggcatgaag
ggtggcgcggcggggggcggctatgcgcaggtgatcccgatggaggacatgaacctgcac
ttcaccggcgatttccacgccatcaccagcgcccataacctgctgtcggcgatgatcgac
aaccacatctactggggcaacgagcaggacatcgacctgcgccgcgtcgtctggcgccgg
gtggtggacatgaacgaccgcgcgctgcgccagatcacctgctcgcttggcggcgtcgcc
aacggcttcccgcgcgagaccggctttgacatcaccgtggcctcggaagtcatggcgatc
ctgtgcctgtcgcgcgatctcgaggatctgcagcaccgtcttggcgagatgatcgtggcc
tatcgccgcgacaagtcgccggtctattgccgcgacatcaaggctgacggggcaatgacc
gtcctcttgaaggacgcgatgcagccgaaccttgtgcagacgctggagaacaacccggcc
tttgtccacggtggcccgtttgcgaacattgcgcacggctgcaactcggtcatcgccacc
accacggcgctgaagctggcggattatgtcgtcaccgaggcagggttcggtgccgatctg
ggcgcggaaaaattcttcgacatcaagtgccgcaaggccgggatcgcgccggatgtggcg
gtgatcgttgccaccgtgcgcgcgctgaagatgaatggcggtgtcgccaaggccgatctc
ggcccggaaaatgtcgcggcggtgaagaagggtctggtgaacctgggccgtcacatcgcc
aatgtcaaaagcttcggcgtgccggtgatcgtggcgatcaaccatttcgtcagcgatacc
gatgccgaggtgcaggcggtgcaggattacgcgcgccagaacggcgtcgaggcgatcctt
tgcaagcactgggccgatggctcgcagggcacgctggatctggcccgcaaggtggtcgag
atcgccgagaagggcgcggctgagttcgccccgctctatcccgacgagatgccgcttttt
gccaagatcgagaccatcgccaagcgcatctaccatgccgacgaggtgatcgccgacagc
aagatccgcgcccagctgaaggactgggaagaacagggttacggtcatctgccgatctgc
atggccaagacccagtacagctttaccaccgacccgacccggcgcggcgcgccgaccggc
cattcggtgcccatccgcgaggtgcggctggccgccggcgcgggcttcattgtcgccatc
tgcggcgaggtgatgaccatgccgggcctgccgcgaacgcccgccgccgaggtgatcggg
ctgaacccctcgggcgaggttcagggcctgttctag

DBGET integrated database retrieval system