KEGG   Paracoccus zhejiangensis: CX676_09795Help
Entry
CX676_09795       CDS       T05233                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00860  Porphyrin and chlorophyll metabolism
pzh00970  Aminoacyl-tRNA biosynthesis
pzh01100  Metabolic pathways
pzh01110  Biosynthesis of secondary metabolites
pzh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CX676_09795
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CX676_09795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pzh01007]
    CX676_09795
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pzh03016]
    CX676_09795
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pzh02048]
    CX676_09795
Enzymes [BR:pzh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     CX676_09795
Amino acid related enzymes [BR:pzh01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CX676_09795
Transfer RNA biogenesis [BR:pzh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CX676_09795
 Prokaryotic Type
   Other AARSs
    CX676_09795
Prokaryotic defense system [BR:pzh02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CX676_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AUH64417
UniProt: A0A2H5EYQ4
Position
complement(2028945..2030270)
Genome map
AA seq 441 aa AA seqDB search
MTTTRFAPSPTGHIHVGNLRTALFNYLIARKAGGSFILRLDDTDQERSKEEYADGIKRDL
DWLGLNWDRVERQSLRLDRYAEAANQLRGSGRLYEVFETPTELDLKRKKQLNMGKPPVYD
RAGHALSEADKDRLRAEGREGYWRFLLDQERIEWTDGILGDISIDAASVSDPVLIRADGQ
VLYTFASSVDDTDMGVTDIVRGADHVTNTATQIQIIKAIGGTPPRFAHHSLLTGAQGEEL
SKRIGALSIRDLREAGVAPEALLSMMARLGSSQPVELRMSLDELADGFDLSQFGASPTKF
DADDLWPLTRERNQHLPFAAVQDRIAALGVPADLAERFWRVASHNITKLNDLAGWWTIFS
EGAEPQIEPEDADFIAEAMKLLPPPPYTDATWGEWTAAVKEATGRKGKGLFMPLRKAVTG
QAHGPEMADVMPLLQVVRARG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacccgcttcgccccgtcgcccaccggccacatccatgtgggcaacctgcgc
acggcgctgttcaactatctgatcgcacgcaaggcgggcggcagcttcatcctgcggctg
gacgataccgaccaggaacgcagcaaggaagaatatgccgatggcatcaagcgcgatctg
gactggctgggcctgaactgggaccgtgtcgagcgccagtcgctgcgtcttgaccgctat
gccgaggcggcgaaccagctgcgcggcagcggccggctttacgaggtgttcgagaccccg
accgagctggacctgaagcgcaagaagcagctgaacatgggcaagcccccggtctatgac
cgtgccggacacgcgctgtccgaggccgacaaggaccgcctgcgggccgaggggcgcgag
ggctactggcgcttcctcttggaccaggagcgcatcgaatggacggatggcatcctgggc
gatatttccatcgacgcggcctcggtcagcgatccggtgctgatccgcgccgacgggcag
gtgctgtataccttcgccagttccgtcgatgacaccgacatgggcgtcaccgacatcgtg
cgcggtgccgaccatgtgaccaataccgccacccagatccagatcatcaaggccatcggc
ggcacgcccccgcgtttcgcccatcacagccttctgaccggggcgcagggcgaggaattg
tcgaagcgcatcggcgcgctgtcgatccgcgatctgcgcgaggcgggcgtggcgcccgag
gcgcttctgtcgatgatggcgcgcctgggttcgagccagccggtcgaactgcgcatgtcg
ctggacgaattggcggacgggtttgatctgtcgcaattcggtgcctcgccgaccaagttc
gacgccgatgacctgtggccgctgacccgcgagcggaaccagcacctgcccttcgccgcc
gtgcaggaccgtatcgccgcgcttggcgtgccggccgatctggcggaacgtttctggcgc
gtggccagccacaatatcaccaagctgaacgatctggccggctggtggacgatcttcagc
gagggcgccgagccgcagatcgagcccgaggatgccgatttcatcgccgaggcgatgaaa
ctgctgccgccgccgccctataccgatgcgacctggggcgagtggaccgccgcggtgaaa
gaggcgacgggccgcaagggcaagggcctgttcatgccgctgaggaaggcggtgaccggg
caggcgcatggtcccgagatggctgatgtgatgccgcttctgcaggtcgtccgggcgcgg
ggctga

DBGET integrated database retrieval system