KEGG   Paracoccus zhejiangensis: CX676_16905Help
Entry
CX676_16905       CDS       T05233                                 

Definition
(GenBank) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00030  Pentose phosphate pathway
pzh00480  Glutathione metabolism
pzh01100  Metabolic pathways
pzh01110  Biosynthesis of secondary metabolites
pzh01120  Microbial metabolism in diverse environments
pzh01130  Biosynthesis of antibiotics
pzh01200  Carbon metabolism
Module
pzh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pzh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CX676_16905
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CX676_16905
Enzymes [BR:pzh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CX676_16905
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CX676_16905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH ApbA 3HCDH_N IlvN NAD_Gly3P_dh_N 2-Hacid_dh_C NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: AUH66433
UniProt: A0A2H5F4H1
Position
3487052..3488452
Genome map
AA seq 466 aa AA seqDB search
MGNCDIGLIGLGTMGSALALNIAEKGFDIAVFNRTTSVTRDFAAEAGPLADRITPAESLQ
ALVEALKTPRMILLMVPAGKVVDDQIAALLPLLGPDDLIIDAGNANFNDTNRRMAELPGR
FLGIGVSGGEEGARHGPSIMGGGPRANWDRAAPILTAIAARYKDQPCADWMGEDGAGHFV
KTVHNGIEYADMQLIAEVYGIMRDGLGMDAAAVAEVFRGWNEGPLQSYLVEITAEVAAAS
DAATGGPVLDVIVDAAGQKGTGRWTAIEAQHLGAPIPVIDAAVTARNISALRARRAEMQA
IFGAGPQPITTDAPEMAVLEQALICGKILCYDQGFGMIAAASKQFGWSLNGAAIARVWRA
GCIIRSAMLDDMASALEAAPDAPLMAAPTFADHLKRTEGALRRVVALAALHGIAVPAHSA
ALAYFDAMRTARGTANMLQGQRDYFGRHGFERLDDGTKDQHGPWAG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggtaattgcgatatcgggctgatcggccttggcaccatgggcagcgcgctggcgctg
aacatcgccgaaaagggctttgacattgccgtcttcaaccgcacgaccagcgtcacccgc
gatttcgcagccgaagccggtccgctggccgaccggatcaccccggccgaatcgctgcag
gcgctggtcgaggcgctgaagaccccgcggatgatcctgctgatggtgccggcgggaaag
gtcgtcgacgaccagattgccgcgctgctgccgctgctcggtcccgacgacctgatcatc
gatgcgggcaacgccaacttcaacgacaccaaccgccgcatggctgaattgcccggccgc
ttcctcggcatcggcgtctcgggcggcgaagagggcgcgcgccacggtccctcgatcatg
ggcggcgggccgcgcgcgaactgggatcgcgcggcaccgatcctgaccgccatcgccgcg
cgctacaaggatcagccctgtgccgactggatgggcgaggacggcgccggccatttcgtc
aagaccgtgcataacggcatcgaatatgccgacatgcagctgatcgccgaggtctatggc
atcatgcgcgacgggctgggcatggatgccgctgccgtggccgaggtgttccggggctgg
aacgagggcccgctgcaatcctatctggtcgagatcaccgccgaggttgccgccgccagc
gacgccgcgaccggcggaccggtgctcgacgtgatcgtcgatgcggcggggcagaagggc
accggccgctggaccgccatcgaggcacagcatctgggcgcaccgatcccggtcatcgac
gccgccgtgactgcgcgcaacatctcggccctgcgcgcccgccgggccgagatgcaggcg
atctttggtgccggcccgcagccgatcaccacggatgcgccggagatggcggtgctggaa
caggcgctgatctgcggcaagatcctttgctacgatcagggtttcggcatgatcgccgcc
gccagcaagcaattcggctggtcgctgaacggcgcggccatcgcccgggtctggcgcgcg
ggctgcatcatccgctcggccatgctggatgacatggcctcggcgctggaggccgcaccc
gatgcgccgctgatggccgcgcccacctttgccgatcacctgaagcgcaccgagggcgcg
ctgcgccgcgtcgtggcactggccgcgctgcacgggatcgcggtgccggcgcattcggcg
gctctggcctatttcgacgccatgcgcacggcgcgcggtacggcgaacatgctgcagggc
cagagggattatttcggccgccacgggttcgagcggctggatgacgggacgaaggaccag
cacggcccttgggcggggtag

DBGET integrated database retrieval system