KEGG   Phenylobacterium zucineum: PHZ_c1515
Entry
PHZ_c1515         CDS       T00750                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PHZ_c1515 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pzu02044]
    PHZ_c1515 (trbE)
Enzymes [BR:pzu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PHZ_c1515 (trbE)
Secretion system [BR:pzu02044]
 Type IV secretion system
  Trb secretion system protein
   PHZ_c1515 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 TraG-D_C AAA_22 ABC_tran AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ACG77926
UniProt: B4RAB9
Position
1717836..1720286
AA seq 816 aa
MFDLREYRRRAAQLPDFLPWAALVEPGVVLNKDGGFQRTARFRGPDLDSATASELVSAAG
RLNNALRRLGSGWAVFVEAQRNAADVYPLSDFPDPVSALVDEERRAQFEEHGAHFDSAYF
LTFVFLPPAENTARAESWLYEGRERRGVDWREALAGFVDRTDRVLALLEGFVPEAEWLTD
AETLTYLHSTVSTHRHRVGVPDTPMHLDVLLADQPLTGGLEPRLGTAHLRVLTISGFPAA
TWPGLLDDLNRLAFPYRWSTRAICLDKVDAAKLLGRIRRQWFAKRKSIMAILKEVLTNEA
AALVDTDAQNKALDADEALQDLGADVVGHAFVTATVCVWDEDAGRADAKLRLVEKAIQAR
DFTCMVESINAVEAWLGSLPGHAYANVRQPPISTLNLAHMIPLSAVWAGPQRNAHLNGPP
LFFAQTEGSTPFRFSTHVGDVGHSMVVGPTGAGKSVLLALMALQFRRYPAGQVFAFDFGG
SIRAAALAMGGDFHDLGGALADDETPPVALQPLGRIQDLAERAWASEWLAGVLAREGVAV
TPEVKEHLWTALGSLASAPEAERTLTGLSVLLQSNALKRALQPYTVAGPWGRLLDAESER
LGSASVQAFETEGLVGSAAAPAVLSYLFHRIQSRLDGRPTLVVVDEGWLALDDATFGAQL
REWLKTLRKKNASVVFATQSLADIETSAIAASIIESCPTRIFLPNDRAQEPQIAAAYARF
GLNERQVEILGRAIPKRDYYCQSRRGNRLFELGLGPVALAFCAASAKADQLVIAELLEHH
GPGGFAAAWLEHRGLPWAADLIRLQAKAPPQLETAR
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgttcgatcttcgcgagtaccgccggcgtgcggcccagcttcccgactttctgccgtgg
gcggcgctcgtcgagccgggcgtggtgctcaataaggacggggggtttcagcgcacagcg
cgcttccgcgggcccgacctggactcggcgaccgcgtccgagctcgtctcggccgcgggg
cggctgaacaatgcgctgcgacgcctcgggtccggctgggccgtgttcgtcgaagcccag
cgcaatgcggccgacgtgtatccgcttagcgacttccccgacccggtgtcggcgctggtg
gacgaggagcgccgggctcagttcgaggaacatggagcgcatttcgacagcgcctacttc
ctgaccttcgtcttcctgccgcccgccgagaacaccgcccgggctgagtcctggctgtac
gaggggcgagagcgccgcggcgtcgactggcgcgaggcgctggccggcttcgtcgaccgg
acggatcgtgtgctggcgctgctcgaaggctttgtgcccgaagcggagtggctcaccgac
gccgagaccctgacctacctgcattcgacggtgtcgacccaccgccaccgcgtcggcgtg
ccggacacgcccatgcatctggatgtgctgctggccgaccagccgctcaccggcggcctc
gagccgcggctgggaacggcgcacctgcgggtgctgaccatcagcggcttcccggccgcc
acctggcccgggctgctcgacgacctcaatcgcctggcgtttccctaccgctggtccacg
cgcgcgatctgcctggacaaggtcgacgcggccaagctgctgggccggatccgccgccaa
tggttcgccaagcgcaagtcgatcatggcgatactgaaagaggtgctgaccaacgaagcc
gcggcgctggtcgacaccgacgctcagaacaaggcgctcgatgccgacgaggccctacag
gacctgggcgccgacgtggtcgggcatgccttcgtgaccgccacggtgtgcgtctgggac
gaggacgcgggccgcgccgacgcgaagctgcggctggtcgagaaggcaatccaggcccgc
gacttcacctgtatggttgagagcatcaacgcggtggaagcctggctcggcagccttccg
ggccacgcctacgccaatgtgcgccagccgccgatctccaccctgaacctggcccacatg
atcccgctttcggcggtgtgggctgggccgcagcggaacgcgcacctgaacgggccgccg
ctgttcttcgcccagacggaaggctcgacacccttcaggttctcgacccacgtcggggac
gtcggccacagcatggtggtggggccgaccggggcagggaagagcgtgctgttggcgctg
atggccctgcagttccgccgctaccccgccggccaggtcttcgccttcgacttcggcggc
tcgatccgagccgcggcgctggcgatgggcggcgacttccacgatctcggcggagcgctc
gcggacgatgagactccgccggtcgccctgcagccgctgggccgcatccaagatctggct
gaacgcgcgtgggcttcggagtggctggccggcgtgctggcccgagaaggtgtcgcggtt
acgcctgaggtgaaggagcatctctggaccgcgctcggatcgctggcctcggcccccgag
gccgagcggaccctcaccggcctgtcggtcctgctgcagtccaacgcgctcaagcgcgcc
cttcagccctacaccgtcgcgggtccgtggggtcggctcctcgacgcagagagcgagcgc
ctgggttcggcctccgtgcaggcgttcgagaccgaggggctcgtgggctcggcggcggcg
ccggccgtgctcagctacctgttccatcgaatccagtcgcggctcgatgggcgcccgacc
ctggtggtggtcgacgaaggctggctcgccctcgacgacgccaccttcggagcccagctg
cgggaatggctgaagacgctgcgcaagaagaacgcctccgtggtgttcgccacccagtcc
ctggccgacattgagacgagcgcgatcgcagcctcgatcatcgaaagctgccccacccgc
atcttcctgccgaacgaccgcgcgcaggagccgcagatcgcagcggcctacgcgaggttc
ggtctcaacgagcggcaggtggagatcctgggtcgggcgatcccgaagcgcgactactac
tgccagtcccgtcgcgggaaccggctcttcgagctcgggctagggccggtggcgctcgcc
ttctgcgccgcttccgccaaggcggaccagctggtgatcgccgagcttcttgaacaccac
ggcccgggtgggttcgcggccgcttggctcgaacaccgggggcttccgtgggcggcggac
ctgatccgcttgcaggccaaagcgccacctcaattggagaccgctcgatga

DBGET integrated database retrieval system