KEGG   Phenylobacterium zucineum: PHZ_c2351
Entry
PHZ_c2351         CDS       T00750                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03200  type IV secretion system protein VirB5
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PHZ_c2351
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pzu02044]
    PHZ_c2351
Secretion system [BR:pzu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   PHZ_c2351
SSDB
Motif
Pfam: T4SS DUF4141
Other DBs
NCBI-ProteinID: ACG78761
UniProt: B4RFU8
Position
2663458..2664186
AA seq 242 aa
MARPLPASPTRGAMKPLCLPLMLGAISAATPAAAQLVVHDPTNYGSLLRQAQTALDQLNA
MKAQLEESRRLYDGFNTASGAGGLAPRLTTPELRDFIPNLDAYVAAARGDLGGLGTLGAQ
AKGIREGARLHAAPADPDLERQGDRAARDLAVGLAAARAGGERLTGLQDLASAVDAAPNV
RAVMDLQARVSAEQALIANDQMRLQGLAMAQAAEDRLQAQRLRERAAAASEARLQLYRRS
IR
NT seq 729 nt   +upstreamnt  +downstreamnt
ctggctcgcccccttccagcaagcccgacgcgaggcgcgatgaaacctctttgccttccc
ctgatgctgggggcgatttcagccgccacgcccgccgccgcccagctcgtggtgcacgat
cccacgaactacgggagcctgctcaggcaggcccagaccgcgctcgatcaactgaacgcc
atgaaggctcagctcgaggagagccgccggctttacgacggcttcaacaccgcctcgggc
gcgggagggctcgcgccccggctgacgacgcccgagctccgggacttcatcccgaacctc
gatgcctatgtcgctgccgccaggggtgacctcggcgggctcggaacgctgggcgcgcag
gccaaaggcattcgcgaaggcgctcgccttcacgctgcgcccgccgatcccgatctcgag
cgccagggcgaccgggcggcccgcgacctcgcagtcggcctcgcggccgcacgcgccggc
ggcgaacgtctgacgggcctccaggacctcgccagcgccgtcgacgcggcgcccaacgtc
cgcgcggtcatggacctgcaggcgcgggtctcggccgagcaggcgctgatcgccaacgac
cagatgcggctccagggcctggctatggcccaggccgcagaagatcgcctgcaggcccag
cgcctgcgtgagcgcgctgccgcggcctcggaagcgcggctccagctctacaggcgcagc
atccgatga

DBGET integrated database retrieval system