KEGG   Phenylobacterium zucineum: PHZ_c2363Help
Entry
PHZ_c2363         CDS       T00750                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00071  Fatty acid degradation
pzu00072  Synthesis and degradation of ketone bodies
pzu00280  Valine, leucine and isoleucine degradation
pzu00310  Lysine degradation
pzu00362  Benzoate degradation
pzu00380  Tryptophan metabolism
pzu00620  Pyruvate metabolism
pzu00630  Glyoxylate and dicarboxylate metabolism
pzu00640  Propanoate metabolism
pzu00650  Butanoate metabolism
pzu00900  Terpenoid backbone biosynthesis
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
pzu01212  Fatty acid metabolism
pzu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHZ_c2363
   00630 Glyoxylate and dicarboxylate metabolism
    PHZ_c2363
   00640 Propanoate metabolism
    PHZ_c2363
   00650 Butanoate metabolism
    PHZ_c2363
  Lipid metabolism
   00071 Fatty acid degradation
    PHZ_c2363
   00072 Synthesis and degradation of ketone bodies
    PHZ_c2363
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHZ_c2363
   00310 Lysine degradation
    PHZ_c2363
   00380 Tryptophan metabolism
    PHZ_c2363
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PHZ_c2363
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PHZ_c2363
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PHZ_c2363
Enzymes [BR:pzu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PHZ_c2363
Exosome [BR:pzu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHZ_c2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin DUF3606
Motif
Other DBs
NCBI-ProteinID: ACG78773
UniProt: B4RFW0
Position
complement(2675962..2677146)
Genome map
AA seq 394 aa AA seqDB search
MNSDPVVIAAYARTPMGGFQGVLSGVKATELGAAAVKAAVERAGVSPEAVEQILMGCVLP
AGLGQAPARQAALGAGLPTSVEATTVNKMCGSGMQAAILAHDALAAGTADVIVAGGMESM
TGAPYLMTKHRGGARIGHDTMYDHMYLDGLEDAYEPGRLMGSFAEETARQYQFTREAMDE
YAITSLKRAKAATESGAFAKEIVPVQVTDRKGVTTVEHDEQPLKADPAKIPTLKPAFAKD
GGITAANASSISDGAAALVMTRESVAKKLGLNVVARVVSHAAHAHEPSQFTTAPVQAVQK
ALKRAGWSVEDVDLFEINEAFAVVAMIAERDLGIPRDKLNVNGGACALGHPIGASGARIL
ATLLSALEARGAKKGVASLCIGGGEATAMAVELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgatcccgtcgtcatcgccgcctacgcccgcacgccgatgggcggcttccag
ggcgtcctctcgggcgtgaaggccaccgagctcggcgccgccgccgtgaaggccgccgtc
gagcgggcgggcgtctcgcctgaggccgtcgagcagatcctgatgggttgcgtgctgccg
gcgggcctgggccaggcgccggcccggcaggcggcgctgggcgcggggctgccgacctcg
gtcgaggccaccacggtcaacaagatgtgcggctcgggcatgcaggcggcgatcctggcg
cacgacgccctggcggccggcacggccgacgtcatcgtcgccggcggcatggagagcatg
accggcgcgccgtacctgatgaccaagcaccgcggcggcgcccggatcggccacgacacc
atgtacgaccacatgtacctggacgggctggaggacgcctacgagcccggccggctgatg
ggcagcttcgccgaggagacggccaggcagtaccagttcacccgcgaggccatggacgag
tacgccatcacctcgctgaagcgggccaaggcggcgaccgagagcggcgcgttcgccaag
gagatcgtcccggtgcaggtcaccgaccgcaagggcgtgacgacggtcgagcacgacgag
cagccgctgaaggccgacccggccaagatcccgacgctgaagcccgcgttcgccaaggac
ggcggcatcacggcggccaacgccagctcgatctcggacggcgcggcggccctggtgatg
acccgcgagagcgtcgccaagaagctcggcctgaacgtggtggcccgggtggtcagccac
gccgcccacgcccacgagcccagccagttcacgaccgcgccggtccaggcggtgcagaag
gccctgaagcgggccggctggagcgtcgaggacgtcgacctgttcgagatcaacgaggcc
ttcgcggtcgtcgccatgatcgccgagcgcgacctgggcatcccgcgcgacaagctgaac
gtcaacggcggcgcctgcgccctgggccacccgatcggcgcctcgggcgcgcggatcctg
gcgaccctgctgtcggcgctggaagcgcgcggggccaagaagggcgtcgccagcctctgc
atcggcggcggcgaggccacggccatggcggtcgagctggtctga

DBGET integrated database retrieval system