KEGG   Phenylobacterium zucineum: PHZ_c3314Help
Entry
PHZ_c3314         CDS       T00750                                 

Gene name
pit
Definition
(GenBank) phosphate transport transmembrane protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pzu  Phenylobacterium zucineum
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PHZ_c3314 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACG79723
UniProt: B4RB78
Position
3757661..3758677
Genome map
AA seq 338 aa AA seqDB search
MDIGGMSLILIFLIGVALLFDFLNGLHDAANSIATIVSTRVLPARWAVIWAAFFNFIAFL
FFGLHVANTIGKGIIAPDVISDAVIFGALGGAIFWNVFTWLIGIPSSSSHALIGGLLGAG
IAKAGLDPIVWAGVWKTVSGIVISPALGFSLALVLVLLASWAFVKATPPLADSVFRKLQF
VSAALFSLGHGGNDAQKTMGIIAVLLYSHGHLGAEFHVPFWVVITCQAALGLGTLFGGWR
IVHTMGSRITRLTPQQGFCAETGGAIALFFFTNLGIPVSTTHTITGSIVGVGAARRMSAV
RWGVAKSIVWAWVVTIPMAGLTGALFYWAARLLDRAFS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcggcggcatgagcctcatcctgatcttcctgatcggggtcgcgctcctattc
gacttcctgaacggcctgcacgacgcggccaactcgatcgccaccatcgtctcgacgcgg
gtgctgccggcccgctgggcggtgatctgggcggcgttcttcaacttcatcgccttcctg
ttcttcggcctgcacgtggccaacaccatcggcaaggggatcatcgcccccgacgtgatc
tcggacgcggtgatcttcggagcgctgggcggggcgatcttctggaacgtgttcacctgg
ctgatcggcatcccttcctccagctcgcacgccctgatcggcggcctgctgggcgcgggc
atcgccaaggcggggctcgacccgatcgtctgggcgggggtgtggaagaccgtctcgggc
atcgtcatctcgcccgccctgggcttcagcctggccctcgtcctggtgctgctggcctcc
tgggccttcgtgaaggccaccccgccgctggcggacagcgtcttccgcaagctgcagttc
gtctcggccgccctgttctcgctgggccacgggggcaacgacgcccagaagaccatgggc
atcatcgccgtgctgctctactcccacggccacctgggggcggagttccacgtccccttc
tgggtggtcatcacctgccaggcggcgctgggccttggcaccctcttcggcggctggcgg
atcgtgcacacgatgggatcgcggatcacccgccttacgccccagcagggcttctgcgcc
gagaccggcggcgccatcgccctgttcttcttcaccaacctgggcatcccggtttccacc
acccacaccatcaccggctcgatcgtcggcgtcggcgcggcccggcgcatgtcggccgtg
cgctggggcgtggccaagagcatcgtctgggcctgggtcgtgacgatccccatggccggc
ctgaccggggcgctgttctactgggcggcccgtctcctcgatcgggcgttcagctag

DBGET integrated database retrieval system