KEGG   Phenylobacterium zucineum: PHZ_p0309Help
Entry
PHZ_p0309         CDS       T00750                                 

Definition
(GenBank) putative amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00970  Aminoacyl-tRNA biosynthesis
pzu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PHZ_p0309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_p0309
Enzymes [BR:pzu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PHZ_p0309
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PHZ_p0309
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_p0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACG80251
UniProt: B4RIS6
Position
unnamed:complement(357255..358661)
Genome map
AA seq 468 aa AA seqDB search
MDFRKTTIEALVGDIRARKVSAREVTAAALANVEATRQINAVCELAADRALSDAAVLDAR
LKSGDAIGPLAGVPLLVKDLEDAVGLRTTFGSALHVDAPPASGDSALVRRLKAAGAVVVG
KANTPAFGFKGVTENLPFGVTRNPWNTDYHAGGSSGGSAAGVAAGIVPLATGSDGGGSIR
IPAAVCGFSGIKTTQGQVPVGGASAPGSGILTVKGPMALRVRDTALALDASRGPDPEDAF
SLHHDGICWRAALDADNLPRKVVWSPTMGFARVDREILARCGTVVDALANAGVAVVERQT
VWSENPLSAWYVIWAAQRARTQGHLKGSPDWERIDPDLRMQIEDGLRFSAPDYANALHLA
HSLAFQLNEAIGDADVLLTPTLAGHPPAVGQEGTIDGEPVGTQWVQMTPAINMTRNPAGA
APIGNSAAGLPMSLQVIGRHREDVRVLKTMCWLEDLLQPRFDAPFGVA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatttccggaagaccaccatcgaagccctggttggcgatatccgcgcccggaaggtc
tcggcgcgcgaggtcacggccgcagcgctggccaacgtagaggcgacacgtcagatcaac
gcggtgtgcgagcttgccgcagaccgagcgctctctgacgccgccgtactcgacgctcgc
ctcaagagcggcgacgcgatcggcccgctcgcgggtgtgccgctactggtcaaggacctc
gaggacgcggtgggtcttcgcaccacgttcggatcggcgctgcatgtcgatgcgccgcca
gcgagcggcgactccgcgctcgtgcgccgtctcaaggctgcaggcgcggtcgtggtcggc
aaggccaacacacctgccttcgggttcaagggggtgaccgagaacctgcccttcggcgtc
acgcgcaatccctggaacaccgactatcacgcaggcggctcgtccggagggtctgctgct
ggcgtggctgcgggcatcgttccgctggccaccggatcggacgggggcggctccatccgc
atcccggcggcggtgtgcggcttttcagggatcaagaccacgcaaggccaagttccagtg
ggaggagccagcgcgccaggctccggcatcctgactgtgaaggggccgatggctctgcgc
gtgcgggacacggcgctggcccttgatgcttcacgaggccccgaccctgaagacgccttc
agtctgcatcacgacggcatatgctggcgcgctgcactggacgccgacaacctgccgcgc
aaggtggtttggtctcccaccatgggatttgcccgcgttgatcgtgaaatcctcgcccgc
tgcggcactgtcgttgacgccctcgcgaacgcaggcgtggcggtggtggagaggcaaacc
gtctggtcggagaacccgctgagtgcgtggtacgtcatatgggcggcgcagcgggcgcgc
acccaaggacacctgaagggatcccctgactgggagcggatcgatcccgatctgcgtatg
cagatcgaggacggccttcgtttttccgcgcccgactacgcgaacgcgctgcatctcgct
cacagcctcgccttccagctgaacgaggccatcggagacgcagacgtgctgctgacaccg
acgttggcgggccatcctcccgccgtgggacaagaggggacaatagacggtgagccggtg
ggtacgcagtgggttcagatgacgcctgcgatcaatatgacacggaaccctgccggcgcc
gccccaatcggcaactctgctgctggactgcccatgagcctgcaggtgatcgggcggcat
cgcgaggatgtacgcgtcctgaagaccatgtgttggctcgaagacctgctccagccccgc
tttgatgcgcctttcggtgtggcctaa

DBGET integrated database retrieval system