KEGG   Quercus suber (cork oak): 111983721Help
Entry
111983721         CDS       T05868                                 

Definition
(RefSeq) putative zinc protease mug138
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:qsu01002]
    111983721
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     111983721
Peptidases and inhibitors [BR:qsu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   111983721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C Peptidase_M16
Motif
Other DBs
NCBI-GeneID: 111983721
NCBI-ProteinID: XP_023871140
Position
Unknown
AA seq 1115 aa AA seqDB search
MAEALHSRSPPSGVERLADALEKPLLDDRSYRVIKLPNQLEALLIHDPDTDKASAAMDVN
VGSFSDGDDMPGIAHAVEHLLFMGTEKYPGENDYNSYLTKYGGYSNAFTASTSTNYYFEL
SAKSTSNSPGASAPSSSENLPSSKTSSPLYGALDRFAQFFVRPLFLEDTLDRELKAVDSE
NKKNLQSDMWRLHQLHKNLSNKQHPYNKFSTGNYKVLRDDPVERGVAIRDEFMKFYADNY
SANRMKLVVLGKEQLDELQSWVEEFFKDVPDQNLKQLRWDEVPIYTQDEIGTQVFAKPVM
DSRSLDIYFQYPDEDEMYASQPGRYLSHLIGHEGPGSILAYLKSKGWANSLSAGASPICP
GSGIFDINIRLTEEGLKHYHEIIKVVFQYIAMIKEQPVHKWIFEEMSKLAEVDFRFKQKS
PASSTTSRLSGIMQKPFPRDQILSAQSLIREFNPEGIKRGLDHLDPDNFRIMVVSKELPG
EWPMKEKWYGTEYKYERVPKQLLQEVKNAYEAPASARPAELHLPAKNEFVPQRLDVEKRE
VAEPARNPSIIRNEPNIRTWFKKDDRFWVPKANVNLCFRSPVAGLTPYTSTLSTLFKELV
EDSLDEYSYDAEIAGLVYGISTHSQGIDVTINGYNDKIAVLLEKVLISMRDLEIKQERFD
IIKERLVRAYKNFDYQEPFRQIQSTTRGLATAQSFTHLEILEELGSITAQEVRDFVPQLL
RQFHIEALIHGNMYKEDALRISDLVSATLNPKSLPQSQWPVRRSVIFAPGSNYYYQHTLS
NPDNVNHCIEYVLIFGDIQDRELRAKIFLLDQIAHEPCFDTLRTKEQLGYVVGSGAIFMN
TTAAYRILIQSERDCEYLDKRIDSFLYAFEKTVAGLSASEFEEHKVSIINKRLETLKNLA
SETNRFWHHISGEMLDFEAVYRDAEAIEKLTQEDFLDFYRTKVLPSSPVRAKLAVHLIAK
ASAGDIAAKIEPSEQKEKLVGLITQLLSQLGVTVDEATLTRKFSSIDITTGETEGIIGAV
RSYLEESAGAAKDQIEQIVTQGQAVLAQALPQLGIQTAKKEDVGGEDLAAKAKAAGVSEP
VLIEDRRAFKAMMPLSKGAVPVRDLSEFEELESKL
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcattgcacagccgctcccctcccagcggagtcgagcgacttgccgacgcc
ctcgagaagccgttgctcgacgatcgatcctaccgcgtcatcaagctcccgaatcagctc
gaggcgctcctgatccatgacccggatacggacaaggcctcggcggccatggacgtcaat
gttgggagcttcagcgacggcgatgacatgcccggcatagcgcacgccgtggagcatctg
ctgttcatgggcacggagaagtacccgggcgagaacgactacaattcctacctcaccaaa
tatggtggatactctaatgccttcaccgcgtcgacttcgaccaactactacttcgaactc
tccgccaaatcgacctcgaacagccctggggcttccgcgccgagcagttcagaaaatctt
ccatcgtcgaaaacctcgtcaccgttatatggagcgctcgatcgattcgcgcaattcttc
gtccgaccactctttcttgaggacacactggaccgggagttgaaagcggtggactcggaa
aacaagaagaatctgcagagtgatatgtggagactgcaccagctacacaagaacctgtcg
aacaaacagcatccctacaacaagttctcgacgggcaactacaaggttctgcgtgacgat
ccggtggagcgtggtgtggccatcagagatgagttcatgaagttttatgcggacaattac
tcggcgaatcgaatgaagctggtggtcttgggcaaggagcagctggacgagctacagagc
tgggtggaagagttcttcaaggatgtgccagaccaaaatctcaagcagctccggtgggat
gaggtgccgatatatacccaggacgagatcggcacgcaggtcttcgccaagccggtcatg
gattcccgatcgttagacatctacttccagtatccggacgaggacgagatgtacgcatcc
caacctggacggtacctgagccacttgatcgggcacgaaggccccggcagtatcttggct
tacctcaaatccaaaggatgggccaactccttgagcgccggcgcgtctcctatctgcccc
ggatcaggcatcttcgacatcaacatccgattgacagaggaagggttgaagcactaccac
gagatcatcaaggtcgtcttccagtacatcgccatgatcaaggagcagccggtacacaaa
tggatcttcgaagagatgagtaagctcgccgaagtagattttcgcttcaaacagaagtct
ccagcgtcatccacgacgagccgtctgagtgggataatgcaaaagcccttccccagagac
cagatcttgagcgcgcagtcattgatccgcgaattcaacccggaaggcatcaagagaggt
ctcgaccatctagatccggacaacttccgtatcatggttgtgagcaaggaactacctggg
gaatggccgatgaaggaaaagtggtacggtaccgagtacaagtacgaacgagttccgaag
caacttctgcaagaggtcaagaacgcgtatgaagctccggcgagcgcgaggccggcggag
ctccatctgcccgccaagaacgaatttgtccctcaacggctcgacgtggagaagcgagag
gtcgcagagcccgcgcgcaatcccagcatcatccgcaatgagccaaacatccgtacctgg
ttcaagaaagatgaccggttctgggtgcccaaggctaacgtgaacctatgcttccggtcg
cccgtcgccggtctgaccccgtacacctctaccttgagtacactgtttaaggagctggtc
gaggattctctcgatgagtattcctacgatgcggaaattgccggcctggtctacggcatc
tcgacgcattctcaaggcatcgatgtcaccatcaacgggtacaacgacaagatcgccgtg
ctgctcgaaaaagtgctcatctcgatgcgcgatctcgagatcaaacaagaacgcttcgac
atcatcaaggagcgtctggttcgcgcgtacaagaattttgactaccaagaaccgttccgc
cagatccagagcacgacacgtggacttgctaccgctcagtcgttcacgcatctagagatt
ctcgaggaactgggctcgatcacggcgcaggaagtccgcgactttgtgcctcaattgctc
cgacaattccacatcgaggctctcattcatggaaacatgtacaaggaagatgcgctgcgc
atctcagacttggtatccgcaactctcaaccccaaatcgctgccgcaaagccagtggccg
gtgaggagaagtgtcatcttcgcacccggcagcaactattactatcagcacaccctctcc
aacccggacaatgtcaatcactgcatcgaatacgtgctgatctttggtgacatccaagac
cgagagctccgggcgaaaatcttcctcctcgaccagatcgcccacgagccgtgtttcgac
acgctccggaccaaagagcagctcggatacgtcgtgggaagcggtgccatcttcatgaat
accacggcggcctaccgcatccttatccagagcgaacgggattgtgagtacctcgacaaa
cggatcgattcgttcctgtacgcattcgagaagaccgttgcgggactctccgccagcgaa
ttcgaagagcacaaggtcagcattatcaataaaagacttgagacgttgaagaaccttgcc
tccgaaaccaaccgtttctggcatcacatcagtggggagatgcttgattttgaagctgtc
taccgcgatgcagaggccatcgagaagcttacgcaagaggatttcctggatttctatcgc
accaaagttctgccttcttcgcctgtgcgtgcgaaactagccgtgcacttgattgcgaaa
gcctcggctggagacatcgccgcgaagatcgagccctccgagcagaaggagaagcttgtc
ggtctcatcacgcaactgctcagtcagcttggcgtcactgtcgacgaggccaccctcacc
agaaaattcagcagcatcgacatcacgaccggcgagacggaaggcatcattggcgctgtg
cgctcgtacctcgaagaatctgctggcgctgcaaaggatcagatcgagcagatcgtcacc
caaggacaagccgtcctcgcacaagcgctgcctcagttgggcattcaaactgccaagaaa
gaggacgtcgggggtgaagacttggccgcgaaggccaaggccgctggtgtcagcgagccg
gttttaatcgaggaccgtcgggctttcaaggccatgatgccgctcagcaagggtgcggtg
cccgtcagggacctcagtgaattcgaggagctggagtctaaactctga

DBGET integrated database retrieval system