KEGG   Quercus suber (cork oak): 111985671Help
Entry
111985671         CDS       T05868                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00260  Glycine, serine and threonine metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    111985671
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     111985671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 OKR_DC_1 Cys_Met_Meta_PP HP0268
Motif
Other DBs
NCBI-GeneID: 111985671
NCBI-ProteinID: XP_023873092
Position
Unknown
AA seq 369 aa AA seqDB search
MVAEKQTFQAKMVTRTVDLRSDTVTKPTETMRAAMATADVDDDVLCHDPTALRLETEMAR
ITGKEAALFVPSGTMGNLISVLVHCDIRGSEVVLGNNSHIHIYENGGISTIGGVHPRTVK
NNEDGTMDIDLIEAAIRDPRWALVFPITRLICLENTHANSGGKCLSVEYTDQVGELAKKH
GLKLHIDGARIFNASVALGIPVHRLLQAADSASICLSKGLGAPVGSVIVGSNSFIAKAKI
LRKTLGGGMRQVGILCAAAIVAVQENVAKLEGDHKNAKVLAEGLNKIKGIRVDAASVETN
IFYFDIEESSKHTAESLSKYLQQRGILVMLEDPSRVRIVLHHQISESDVQYTLSCFQQAL
IGVLDQNGI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagaaaaacaaacctttcaagcaaaaatggttactagaactgtggatctccgg
tctgacacagtcaccaaaccaactgaaacaatgcgggctgctatggctactgctgatgtt
gatgatgatgttttgtgccatgacccgactgctttacgcctagaaacagaaatggcaagg
atcacaggcaaggaggcagccctatttgttccctcaggcacaatgggtaacctcattagt
gtgcttgtacattgtgacattagagggagtgaagtagttcttggaaacaattcccatata
catatctatgagaatggtggcatttcaacaattggaggtgtacatccgaggactgtgaag
aacaatgaagatggaacaatggatattgatttgattgaagccgccattagagatcctaga
tgggcgcttgtgttccccattacaaggcttatctgcttggaaaatactcatgcaaattct
ggaggtaaatgtttgtctgtagagtatacggatcaagttggtgagcttgctaagaagcat
ggtttgaagcttcatattgatggggcccgcattttcaatgcatcagttgctctaggaatt
cctgttcataggctgttgcaagctgctgactcagcttcgatatgtctatcgaaaggactg
ggtgctccagttggatctgttattgttggttccaatagctttattgccaaggctaaaata
ctcaggaaaaccttaggtggtgggatgagacaggttggaattctttgtgctgctgctatt
gtcgcagtacaagagaatgttgcaaagctagagggtgatcacaagaatgctaaggttcta
gcagaaggattgaataaaattaaaggaataagagtggatgctgcttcagtagagaccaat
attttctattttgatatagaagagagctcaaagcatacagcagaatcactaagcaagtac
ttacaacaacgtggtatactcgtgatgttagaggacccatcaagagtcaggatcgtcctc
caccaccaaatttctgaaagcgatgtgcaatacaccttgtcatgctttcagcaagctcta
attggagtacttgatcaaaatggcatctag

DBGET integrated database retrieval system