KEGG   Quercus suber (cork oak): 111986185Help
Entry
111986185         CDS       T05868                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    111986185
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111986185
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111986185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRR_1 LRR_6 Pkinase_fungal RIO1 APH
Motif
Other DBs
NCBI-GeneID: 111986185
NCBI-ProteinID: XP_023873576
Position
Unknown
AA seq 594 aa AA seqDB search
MQLVRYFLHPSRKYYYIKLDELWLESWSRCPQLGTLRIAGNGIGGGIPPEIGNFTQLHVL
DLSYNRLVGKLPKDFGKLTSLVTLKLNGNQLSGDISPELGSLTNLEYLDLSSNRFDNSIP
RIVGNFLKLNYLNMSNNKFCHDIPVEICNLAHLSQLDLSHNSLEGKIPSQIGKLQSLEML
NFSHNNLSGFIPIAFEEMHGFSYVDISYNELEGPLPNTKAFQDACIEALRGNKRLCGNVT
GLQPCVVGRPVSKTGSKIFLLIIFPLFGTLSLALMFLGVFLILQRNRKDPHIDQTTNTHN
EKVFSISTFDGKAMYKEIIEATQGFDDMFCTGKGKHGTVYKATLTSGNAVAVKKLQSLCD
GEIVQQKEFFNEIRALTEIHHRNIVKLHGFCSQSQHSILIYEYFERGSLATILSSDGGAK
ELDWNKRMNIIKGLAHALSYMHHDYSPPIVHGDISSKNVLLDSDYEAHVSDFGTAKLLNR
DSSNWTSFADTCGYAAPELAYTMKITEKCDVFSFGVLAIEVIKGRHPGEITSILSASSME
ENILLKDLFDLRIPPPMLQAENQLILIIKLAIECLRANPESRPTMHMVSRVLSS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcagttggttcggtatttcttgcacccaagcaggaagtattactacattaaacttgac
gaactctggcttgaaagttggagtaggtgcccgcagctaggcaccctgcggattgctggg
aatggtattggcggtggcataccacctgaaattggaaacttcactcaactccatgtactt
gatctttcttataatcggttggttgggaaactaccaaaggactttgggaagttgacttct
ttggtgacattgaagttgaatggaaaccaactttctggtgatatatctccagagcttgga
tcattgacaaatcttgagtatctggatctatccagtaatagatttgacaactcgatccct
agaattgttgggaactttttgaaactaaactatttgaatatgagcaacaacaagttttgc
catgatattccagttgaaatttgtaatttagctcatttgtcccagctagatttgagtcat
aactcactcgaaggaaagataccttcacaaattggcaagcttcaaagcttggagatgttg
aatttctcccacaataacctctctggttttattccaattgctttcgaagagatgcatggt
ttttcatatgtggacatatcctataatgagttggagggccctcttcccaataccaaggca
tttcaagatgcttgcatagaagcactacgaggaaataaaaggttgtgtggaaatgttaca
ggattgcaaccctgtgtggtaggaagaccagtttcaaagacaggatccaaaatctttttg
ttaatcattttccctctttttggaacactgtcacttgcattgatgtttcttggagttttc
cttattttgcaaagaaataggaaggaccctcatatagatcaaacgactaacacacataat
gaaaaagtgttttcgatatcaacttttgatggaaaagcaatgtacaaggaaatcattgaa
gcaacacagggttttgatgatatgttttgtactgggaagggaaaacatggaaccgtgtat
aaagcaactctaacatcaggaaacgcagtggcagtgaagaaactccaatccttgtgtgat
ggtgagattgtacaacaaaaagagttcttcaatgagataagggcattaacagaaatacac
caccgaaacatcgtaaaattgcatggcttttgttcacaatcacaacactcgattttgatt
tatgagtactttgaaaggggtagcttggccacaattttgagcagtgatggaggagcaaag
gagttggactggaataagaggatgaatatcatcaaaggtttggctcatgctctatcttac
atgcaccatgattactcaccaccaattgttcacggggacatatcaagcaaaaatgttttg
ctggattcagattacgaggctcatgtttcagactttggcacagctaagcttcttaatcga
gactcatccaattggacttcatttgccgacacatgtggatatgctgcaccagagcttgct
tataccatgaagataactgagaaatgcgatgtgtttagctttggagttttggctattgaa
gtgatcaaaggaaggcatcctggtgaaatcacctccattctatcagcttcatccatggag
gagaatattttgttgaaagatttgtttgacctacgcattccacctcccatgctgcaggct
gagaatcaactgatacttatcataaagctggcaattgaatgcttgcgagcgaatccagaa
tctagaccaactatgcacatggtctctcgggtgttatcaagctga

DBGET integrated database retrieval system