KEGG   Quercus suber (cork oak): 111987730Help
Entry
111987730         CDS       T05868                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr WAK_assoc GUB_WAK_bind YukC APH Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 111987730
NCBI-ProteinID: XP_023875229
Position
Unknown
AA seq 645 aa AA seqDB search
MNSHYLALSSLITLFFFLTILPPSYCNAVEYFDECIRPFNCGRIRNIPYPFWGGNRSELC
GLPGFKLTCRDNEYPYPIIRFKELDFLVLNIDQSHHTMTIARFDPWNSPCPPKLVNTTLD
FNNFDYTPTDQNLTLFYDCPSGVSGLEGASFPCGLGGVGANYFVDESFPGIHELLEECNT
NIKVPILRTALIDESVGGALALQNVLKQGFDVDYHNASSNTCWGCVASGGICSPLPSPHP
FVCFCRDGEQPLVCPSNDKRGSKWFKYALGAGSCFIMVFLIPGVIFFIHRRRMKKKYDPS
TLLSRSISYDPCGTTGLEAFVRNYGPLSTNRYKFSDVKKFTNSFKVKLGQGGYGGVYKGE
LLNGRLVAVKVLNASKGNGDEFINEVASISRTSHVNIVTLLGFCLEGKKRALIYEFMPNG
SLEKFIHSDNTKTTTMPLGLEKLFQIAIGIARGLEYLHRGCNTRILHFDIKPQNILLDEN
FSPKISDFGLAKISPRNESNISMAIARGTIGYIAPEVFSRNFGVVSHKSDVYSYGMMILE
MVGGKKDIDVGISDTSEIYFPHWIYKRLEQYNDLGFPINMTIEETAMVRKMILVGLWCIQ
TNPSDRPSMSKVIEMLEGNIEALQIPPKPFLSSPPRSPVEESSTY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccattatctagctctctcttccctcatcacccttttcttcttcttaacaata
ttacctccatcttactgcaacgccgtcgaatactttgatgagtgcattcgtccctttaat
tgtggaaggatcagaaacattccgtaccctttctggggtggtaatcgatctgaactttgc
ggtttaccagggttcaagcttacgtgccgcgacaatgaatacccatacccaattatcaga
tttaaagaactagatttccttgtactaaacatcgaccaatctcatcataccatgaccatt
gcaagatttgacccctggaatagtccatgtcctccaaagttagtcaataccactttggat
tttaataacttcgattacacaccaaccgatcaaaacctaactttgttctatgactgccct
tctggagttagcggattggagggagcgagctttccctgcggcttaggaggagttggtgct
aattactttgtagacgaatccttcccaggtatccacgagcttcttgaggaatgcaataca
aatattaaagttccaattttacggactgctcttattgacgagtctgtggggggagccctg
gcactacagaatgtattgaaacaaggttttgatgtagactaccataatgcctcgtcgaat
acctgttgggggtgtgtggcatcaggtgggatatgcagtcctctcccctccccccatcca
tttgtctgtttttgccgtgatggagagcaacctttggtctgtccaagtaacgataagcga
ggaagtaagtggtttaagtatgctttaggtgctggctcatgtttcataatggtctttcta
ataccgggcgtcatattctttatccatcgacgccgcatgaagaagaaatatgatccctca
accttactcagtcgaagcatctcttatgatccctgtggaacgacaggtcttgaggcattt
gttagaaattacggaccactatctacaaacagatataaattctcagatgtcaagaaattc
accaattcatttaaggttaaactgggtcaaggaggctatggtggtgtctacaaaggagag
ctactcaatggtcgtctcgtagctgtgaaggtcctgaatgcatcgaaaggaaatggagat
gaatttatcaatgaagttgcaagcatcagtagaacttcccatgttaatattgtcacactt
cttggattttgtcttgaaggtaaaaaaagagctctcatctatgagtttatgccaaatgga
tcacttgaaaagtttatacacagtgacaacacgaagacaaccactatgcccttaggattg
gaaaaattgttccaaattgcaatcggtattgcccgggggcttgagtacttgcaccgtggc
tgcaatactagaatcttgcattttgacataaaaccacaaaacattcttctggacgaaaat
ttttccccaaagatctctgattttggacttgctaaaatttctccaaggaatgagagtaac
atatcaatggcaatagctagagggacaatagggtatattgctcctgaagtgttcagtaga
aactttggagtagtttcacacaaatctgatgtctatagctatggaatgatgattttggag
atggttggaggaaaaaaggacattgatgttggaataagtgataccagtgagatatatttt
ccacattggatatataagcgtcttgagcagtacaatgatttaggatttcccattaatatg
actatagaggaaactgcaatggtgagaaagatgatcttagtgggtttgtggtgcatacag
acaaatccatctgataggccgtccatgagtaaagtaattgaaatgctagaaggaaacata
gaagcattgcaaattcctccaaaacctttcttatcgtcacctccaagatctcccgtagaa
gaatcctccacatattaa

DBGET integrated database retrieval system