KEGG   Quercus suber (cork oak): 111987739Help
Entry
111987739         CDS       T05868                                 

Definition
(RefSeq) receptor-like serine/threonine-protein kinase SD1-7
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    111987739
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111987739
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111987739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase DUF3403
Motif
Other DBs
NCBI-GeneID: 111987739
NCBI-ProteinID: XP_023875246
Position
Unknown
AA seq 182 aa AA seqDB search
MNPAISDFGMARIFKQNELEANTNRIVGTYGYMSPKYAMEGVFSIKSYVYSFDALMLEIM
SGIRNNSFNQSDHVLNLDGYAWDLWKEDKGLDLVDPTTSDSFVTNHVLRCIHVSLLCMEE
GAVDRPTMSDVLSMLTNESTQLPLPNKPAFTIGRKPKRAIIPIKESEVHMANEISISDMD
PR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggcgatctctgattttggcatggcaagaattttcaaacaaaatgaactagaa
gcaaatactaatagaattgttgggacatatggttacatgtctcctaagtatgctatggag
ggtgtgttctctataaaatcttatgtctatagctttgatgccttgatgcttgaaatcatg
agtggtataagaaacaacagcttcaatcagtctgaccatgtgctcaatctagatggatat
gcatgggatttgtggaaagaagataaaggactagacctagttgatccaacaactagtgat
tcatttgttacaaatcatgtgctgagatgcattcatgtcagcctcttatgcatggaagaa
ggtgctgttgatcgccctaccatgtcagatgtgctatctatgttgacaaatgaaagtaca
caattgcctttacctaataaaccagcctttacaattggaaggaaaccaaaaagggcaatt
attcctattaaagaatctgaagttcatatggcaaatgaaatatccatttctgatatggat
ccaagatag

DBGET integrated database retrieval system