KEGG   Quercus suber (cork oak): 111988729Help
Entry
111988729         CDS       T05868                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    111988729
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111988729
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111988729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal PIP49_C Kdo
Motif
Other DBs
NCBI-GeneID: 111988729
NCBI-ProteinID: XP_023876285
Position
Unknown
AA seq 250 aa AA seqDB search
MLLLVVLTNVTIHSSETSVSQQKEFLNEISALTEIRHRNIVKLHGFCSHSRFSILIYEYL
EKGNLASILSNDGGAKELDWNKRVNIIKGVAHALSYMHHDCLPPIVHRDISSKNILLDSE
YEAHVSDFGIAKILNQDSSNWTSLAGTYGYLAPELAYTMKITEKCDMFSFGVLAIEVIKG
KHPGEIISILSASSVEENLLLNDLLDIRLPPPTPEVENHLKLIIKLAIACLHANPKSRPT
MHMVSQILSS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgctacttcttgtagtacttactaacgtgaccatacatagctccgagacttctgtttca
cagcaaaaagagttcttaaatgagataagtgcattaacagaaattcggcatcgaaatatt
gtaaaattgcatggcttttgttcacattcacgtttctcaattttgatttacgagtacctt
gaaaagggtaacttggcctcaattttgagcaatgatggaggagctaaagaattggactgg
aataagagggtgaatatcatcaaaggtgtggctcatgctttgtcttacatgcaccatgat
tgcttaccaccaattgttcatagggacatatcaagcaaaaatatattgctggattcagag
tacgaggctcatgtttctgactttggcatagctaagattcttaatcaagactcatccaat
tggacttcacttgcaggcacatatggatatcttgcaccagagcttgcttatacgatgaag
ataactgagaaatgtgacatgtttagctttggagttttggctattgaagtgatcaagggt
aagcatcctggtgaaatcatctccattctatctgcttcatctgtggaggagaatttattg
ttgaatgatttgttagacatacgccttccacctcccactcccgaggttgagaatcatcta
aaactcataataaagttggcaattgcatgtttgcatgctaatccgaaatccagaccaact
atgcatatggtctctcaaattttatcaagctga

DBGET integrated database retrieval system