KEGG   Quercus suber (cork oak): 111988863Help
Entry
111988863         CDS       T05868                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00600  Sphingolipid metabolism
qsu01100  Metabolic pathways
Module
qsu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111988863
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     111988863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 111988863
NCBI-ProteinID: XP_023876440
Position
Unknown
AA seq 201 aa AA seqDB search
MEQPENPAEQPIVSDRVIINGSETPLTLTADGKLRMRERGQRCLTVEKEVLGFLTEGSKI
RIRAVVQGGGAGICCVASKGALARKDFVFQPLSNDSLNLWSQKLRQYIDSLGRPKRLFVF
VNPFGGKKSASKIFVDHVKPLFDDADIHITLHETQYQLHAKEVASSLDLSKYDGIVCVSG
DGILVEVGLLCLIATKMYYMF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacccgagaacccggcggagcagcccatagtgtctgaccgggtcatcatcaac
ggaagcgagacaccgttaactctaacggcggatgggaagctgaggatgagggagagaggt
caacgttgcttgacggtggagaaagaggtgctcggtttcctaacggagggctcgaagatt
agaatcagagccgtcgtccaaggcggaggagctggaatctgctgtgtcgcgagcaaagga
gctttggcgaggaaggacttcgtgtttcaacccttgtctaatgactctcttaacctctgg
tctcaaaagctccgtcaatacatagactcgctcggtcggcctaaacggctatttgttttt
gtgaacccatttggtggaaaaaaatctgcatccaagatttttgttgatcatgtgaaacct
ctttttgacgacgctgatatccatattacattgcatgaaactcaatatcagcttcatgca
aaagaagtagctagttcacttgatctgtccaagtatgatggcattgtttgtgttagtggg
gatggaatcttggttgaggtaggcttactttgcttaattgctacaaaaatgtattatatg
ttttag

DBGET integrated database retrieval system