KEGG   Quercus suber (cork oak): 111988937Help
Entry
111988937         CDS       T05868                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 25
Organism
qsu  Quercus suber (cork oak)
Brite
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111988937
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111988937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung Haspin_kinase APH Pkinase_fungal ETRAMP
Motif
Other DBs
NCBI-GeneID: 111988937
NCBI-ProteinID: XP_023876513
Position
Unknown
AA seq 1255 aa AA seqDB search
MTGLEKVTGLGEKKSQRHISDVNFFGQTQISPMSLMYNTQNTTSPELNNFYALGLLYDLI
DRAKVTDMLFKSDSQTVKLSDGSKISYGLVQCTRDIDGPSCGQCLSYLMDTAETCCQAKI
GWRILGPSCFLRYENYSFTEQSPAKPLPLPPTPTKPIGGKKATKIVIITISSVASIAVVA
ALLGFWYYSSFGWRKRQDGIISQEISLRNNLAGSFSIELMDSCIYGNDNDNRGEIYYFNL
ITILAATNNFSDANKLGEGGFGPVYKGKLINGKEIAVKRLSMKSKQGLEEFKNEVILIAK
LQHKNLVRLLGCCLEEDEKLLVYEYMVNTSLDAFLFDLDKCKVLDWAKRTNIVNGIAKGL
QYLHEDSRLKIIHRDLKASNVLLDDEMNPKISDFGTARIFESNQIQANTIRIVGTYGYMA
PEYAMEGLFSMKSDVYSFGILMMEIVSGKKNSGFNHLEQAHSLLSYVWQRWNEGKGVELI
DQTIIDTCPISEALRLIHIALLCVQEDPNDRPTMSRVILMLASKSINLPELSAPPFSVGR
LIIFDQSSTIGTRTGLGLVTSDQSSTILLFVLREQHIEENLIFLTLPFGSQFLLKPRRGG
GKMFSLHNTIAFPLLLFAVFSLTSSINSQPTYNDNICLDQSNQTINANYQSNLTVLLNSL
SSKASQNYSFYNDSSNIGIYGLFLCRGDVSNSTCQSCVSYATQDITTRCPSNNSAIIWYD
ECMLRYSNVNFFGQVQTSPEVLMWNVGNTTSPDQPNFSAIALMNFLTGTAVNDDLLFHDG
NLTASNGSDQTYGLVQCTRDINSSGCSSCLSQLIKDAESCCQSKIGLRILTPSCSIRYET
YSFFQQPPVPPPSAPAPPAPPQSSGDGGKKTKKTVIITISSIASIAIVAAVLGFWYYSSS
GRRKRNLDSSIYGRDDDNRGEMNYFNLSTILTATNNFSDANKLGEGGFGPVYRGKLINGN
EIAVKRLSMKSKQGLEEFKNEVILIAKLQHRNLVRLLGCCLEGEEKLLVYEYMANTSLDV
FLFDPKKCKELDWAKRTSIVNGIAKGLLYLHEDSRLKIIHRDLKASNVLLDDEMNPKISD
FGTARIFGGNQIEANTNRVVGTYGYMAPEYAMEGLFSIKSDIYSFGILLLEIASGKKNSG
FYHPEREESLLSYAWRLWNDGKGLEFIDQTIVDTCPISEVLRLIHIALLCVQEDPNDRPT
MSMVVLMLASKLINLPQPSAPPFTESRFIMFDQSSMVGTGAGFVTSDLSSTSAPC
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtctagaaaaggtgacagggttaggagaaaagaaatcccaaagacacatttcc
gatgttaatttctttggacagacgcagatatcgccaatgtcgctcatgtataatacccag
aatactacttcacctgaactaaataatttttacgcacttggtctattgtacgatctaata
gatcgtgccaaggtaacagatatgctgttcaagagtgatagtcagacagtgaaattgagt
gatgggtccaagataagttatgggttggtacagtgtacaagagatatcgatggtccttcg
tgtggccagtgcttaagctacttgatggatacagcggagacatgttgccaagccaagata
gggtggcgcattttaggcccaagttgctttctgaggtatgagaactactctttcaccgag
caatcaccagcaaagccactgccgctgccaccgactcccacaaaaccaataggcggaaag
aaggcaacaaagatcgtaatcattactatatcatcagttgcatcaattgccgtagttgca
gctctcttgggtttctggtattattcatcctttggctggaggaaaagacaagatggaatt
ataagccaagaaatttcgttacgcaataatttagcaggttcgttttcaatagagttaatg
gacagttgtatctatggaaatgacaatgacaacagaggagaaatctattactttaattta
attaccatactggctgctacaaacaatttctctgatgccaataagcttggagaaggtggt
ttcggcccagtttacaagggcaagttgattaatggaaaggaaatagcagttaaaaggctt
tcaatgaaatccaaacaaggtcttgaagagttcaagaacgaagtgattttaattgcaaaa
cttcaacacaagaatctagtgaggctcttgggatgttgcttagaagaagatgaaaagctt
ctagtctatgaatacatggtcaacactagtctcgatgccttcttattcgatctagacaaa
tgtaaggttctagattgggctaaacgcacaaacatagtcaatgggattgctaagggcctt
caatatttacatgaggactctcggctgaaaatcatccatagggatttgaaagcgagtaat
gtgttgttggatgatgagatgaacccaaagatatcagattttggtactgctagaattttc
gagagcaatcaaatacaagccaacactatcagaatcgtgggtacatatggatatatggca
ccagagtatgcaatggaggggctcttttcaatgaagtccgatgtttatagttttggaatt
ctaatgatggaaattgtaagtggaaaaaagaacagtggcttcaatcatctagagcaggca
catagccttctgtcatatgtatggcaacgatggaatgaaggaaaaggagtggaattgata
gatcagaccataattgatacttgtcctataagtgaggctctaagattgatccatatcgca
ttgttatgcgttcaagaagatccaaatgatagacctacaatgtcaagggtcattctcatg
cttgcaagcaaatcaataaatcttcctgagctatcagcacctccattttctgttggtagg
ttaatcatatttgatcaatcttcaacaattggcactagaactggattgggattagtcaca
tctgatcaatcttcaacaattctcttatttgtattaagagaacaacatattgaggaaaat
cttatcttcttgactctaccgtttggaagccagtttctgttgaagccaaggagaggagga
ggtaaaatgttttccctccacaacaccatagcctttccgttattattgtttgcagtgttt
tcccttacaagctccattaattcccagccaacctataatgacaacatatgtttagatcaa
tcaaatcaaaccatcaacgctaattaccaatccaacctcacagtcctgttgaattcttta
tcatctaaagcttcccaaaactacagcttctacaacgatagctccaatattggcatctat
ggtctctttctctgcaggggtgatgtttctaatagtacctgccaaagttgtgtcagctat
gcgacccaagacatcacaactcggtgtccatctaataatagtgcaatcatctggtacgat
gaatgcatgttacgctattccaatgttaatttctttggacaggtacaaacttctccagag
gtactcatgtggaatgtcgggaacacaacctcacctgatcagcccaactttagcgcaatt
gctctaatgaactttctaacagggacagcagtaaatgacgatctgttgtttcatgatggg
aatttgacagcaagtaatggatctgatcaaacttatgggttggtgcagtgtactagagat
atcaatagtagtggttgcagcagttgcttaagccagttgatcaaggatgctgagagctgt
tgccaatcgaaaataggtttgcgtatcttaaccccaagttgcagtataaggtatgagacc
tactctttctttcaacaaccaccagtgccgccgccttcagcaccagcaccaccggcccca
cctcaatcatcaggagatggaggaaagaagacaaaaaagacagtaatcattactatatca
tcaattgcatcaattgcaatagttgcagctgtcttgggtttctggtattattcatcatca
ggcaggaggaaaagaaatttagactctagtatctatggaagggatgatgacaacagagga
gaaatgaattacttcaatttaagtacaatattgactgctacaaacaatttctctgatgcc
aataagcttggagaaggtggttttggcccagtgtacaggggcaagttgattaatggaaat
gaaatagcagttaaaaggctttcaatgaaatcaaaacaaggtcttgaagagttcaagaat
gaagtgattttaattgcaaaacttcagcataggaatctagtaaggctcttgggatgctgc
ttggaaggagaagaaaaacttctagtctatgagtacatggccaacactagtcttgatgtc
ttcttgtttgatccaaagaaatgtaaagaactagactgggctaaacgtacaagcattgtc
aatgggattgctaaaggacttctctatctgcatgaggactctcggctcaaaatcatccat
agggatttgaaagcaagtaatgtattgctagatgatgaaatgaacccaaagatatcagat
tttgggactgctaggatttttgggggcaatcaaatagaagccaacacaaacagagttgtg
ggtacatatggatacatggcgccagaatatgcaatggagggactattttcaataaagtct
gacatttatagcttcgggattctactgctagaaattgctagtggaaaaaagaacagcggc
ttctatcatccagagcgtgaagaaagccttctgtcatatgcatggcgactatggaatgat
ggcaaaggactggaatttatagatcagaccatagttgatacttgtcctataagtgaggta
ctgagattgatccatattgcattgttatgtgttcaagaagatcctaatgatagacctacc
atgtcaatggtcgtactcatgcttgcaagcaaattgataaaccttcctcaaccatcagca
cctccatttacagaaagtagatttatcatgtttgatcaatcttcaatggttggcaccgga
gcaggatttgtcacatctgatctatcttcaacaagtgctccttgctag

DBGET integrated database retrieval system