KEGG   Quercus suber (cork oak): 111991286Help
Entry
111991286         CDS       T05868                                 

Definition
(RefSeq) 4-nitrophenylphosphatase-like
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
qsu  Quercus suber (cork oak)
Brite
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     111991286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 111991286
NCBI-ProteinID: XP_023878832
Position
Unknown
AA seq 303 aa AA seqDB search
MAPPQYLTGDKAGIAAFLDKFDVFLFDCDGVLWSGDHAFPHIPETIEMLRSKGKQLVFVT
NNSTKSRADYKKKFDGMGISCTVDEVFGSSYSAAIYISRILRLSPPHNKVFVLGESGVEQ
ELASEGVPFIGGTDRALNRDITSADYSAIASGAALDPDVAVVLAGLDFHPSYLKWALGMA
YVRAGARFLATNIDSSLPSAGTLFPGAGASAAPLVKATGQEPLALGKPSQAMMDAIEGRF
RFDRSRACMVGDRLNTDIQFGIEGGLGGTLCVLTGVTKREDLLRKGAEVLPSAYVEALGD
MLG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcctcaatatctcaccggcgacaaagctggcattgctgcatttctagacaag
ttcgatgtttttctgttcgactgtgatggcgtcctgtggtctggcgatcatgcgttccca
cacatccccgagacgattgagatgttgcgatccaaaggcaagcaactggtctttgtcacc
aacaacagcaccaaatcccgcgcggattacaagaaaaagtttgatgggatgggaatcagc
tgtacggtggacgaagtcttcgggtcctcctacagcgccgccatctacatctcgcgcatc
ctgcgcctctcgcccccgcacaacaaagtcttcgtgctcggcgaaagcggggtggagcag
gagctcgcgtcggagggcgtgccgttcatcggcggcaccgaccgcgcgctgaaccgcgac
atcacatcggccgactacagcgccatcgcctccggcgccgccctcgacccggacgtggcc
gtcgtgctcgccggcctcgacttccacccctcgtacctgaagtgggcgctcggcatggcc
tacgtgcgcgctggcgcccgcttcctcgccaccaacatcgactcctcgctgccctcggcc
ggcaccctcttccccggcgccggcgcctcggccgcccccctcgtcaaggccaccggccag
gagcctctcgccctcggcaagcccagccaggccatgatggacgccatcgagggccgcttc
cgcttcgaccgctcccgcgcctgcatggtcggcgaccggctgaacaccgacatccagttc
ggcatcgagggcggcttgggcgggacgctgtgcgtgttgacgggcgtcacgaagcgcgag
gatctgctgcgcaagggcgccgaggtgctgccgagcgcgtacgtcgaggcgctgggggat
atgttggggtga

DBGET integrated database retrieval system