KEGG   Quercus suber (cork oak): 111992115Help
Entry
111992115         CDS       T05868                                 

Definition
(RefSeq) probable protein S-acyltransferase 14
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:qsu04131]
    111992115
Enzymes [BR:qsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     111992115
Membrane trafficking [BR:qsu04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    111992115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 111992115
NCBI-ProteinID: XP_023879693
Position
Unknown
AA seq 315 aa AA seqDB search
MHRSGAAMAWNVFKFCTALRGLGSIMILMVLAIVGLSYYTLVIANYGPALFHGALLDSLF
ALAVLLLFHSLLVMLLWSYFSVVLTDPGGVPLNWRPVLDEEKGDMDPLVASDYNGPGLGT
NPSTIDPANPRIRFCRKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFCL
FLFYTFLETTLVTLSLLRYFVGFFTDGEIIGAPGTLAATFITFILNLSFALSVLGFLIMH
ISLMSSNTTTIEAYEKKTNPRWRFDLGWKKNFEQVFGMDRKYWLIPAYSEEDLRRMPALQ
GLEYPTKPDLDGQQF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggtctggtgcagcaatggcgtggaacgtgttcaagttctgtacggctttgcgt
ggactcgggtccatcatgatcttgatggttcttgccattgtgggtctctcttattacact
ctcgtgatagccaattatggccctgctctcttccacggtgctcttctcgattccctcttc
gctctcgctgttttgctcttattccattccttgttggtgatgctattatggagctacttt
tctgttgttctaacggatccgggtggcgttcccctgaactggagacctgtactggacgaa
gagaaaggagacatggatccattggtggcttcagactacaatggaccaggtttaggcaca
aacccgtcaactatagacccagcaaatccgagaatacggttttgtcgaaagtgcaaccaa
tttaaaccaccgcgttgccatcactgttctgtttgcgggaggtgtattttgaaaatggac
catcattgtgtttgggtcgtcaattgtgttggggcattgaactacaagtacttctgtctt
ttcctgttttacacatttcttgagacaactcttgtcactttatcattgctgcggtatttt
gttggatttttcactgatggtgagataatcggagcaccaggcacccttgcagcgactttt
atcacattcattttgaatttatcgtttgcgctgagtgtattggggtttctgattatgcac
atatcattgatgtcgtcaaataccaccacaattgaggcatatgagaagaaaaccaatcct
agatggcgttttgaccttggatggaagaaaaattttgaacaggtttttgggatggatagg
aagtactggttaatccctgcatattcagaagaggatctaagacggatgccagcacttcag
ggtcttgaatatccaacaaagcctgacttggatgggcagcagttctag

DBGET integrated database retrieval system