KEGG   Quercus suber (cork oak): 111992665Help
Entry
111992665         CDS       T05868                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03040  Spliceosome
qsu04141  Protein processing in endoplasmic reticulum
qsu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111992665
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111992665
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111992665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:qsu01009]
    111992665
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:qsu03041]
    111992665
   03009 Ribosome biogenesis [BR:qsu03009]
    111992665
   03110 Chaperones and folding catalysts [BR:qsu03110]
    111992665
   04131 Membrane trafficking [BR:qsu04131]
    111992665
   03051 Proteasome [BR:qsu03051]
    111992665
   03029 Mitochondrial biogenesis [BR:qsu03029]
    111992665
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:qsu04147]
    111992665
Protein phosphatases and associated proteins [BR:qsu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111992665
Spliceosome [BR:qsu03041]
 Complex B
  Other components
   Prp19 complex
    111992665
 Complex C
   Prp19-CDC5 complex
    111992665
Ribosome biogenesis [BR:qsu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111992665
Chaperones and folding catalysts [BR:qsu03110]
 Heat shock proteins
  HSP70 / DNAK
   111992665
Membrane trafficking [BR:qsu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111992665
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111992665
Proteasome [BR:qsu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111992665
Mitochondrial biogenesis [BR:qsu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111992665
Exosome [BR:qsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   111992665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 111992665
NCBI-ProteinID: XP_023880295
Position
Unknown
AA seq 226 aa AA seqDB search
MLKNDGPVTGPLSDAHFMLEEICALNLEIRWSKIIPRNTTLPTSKSEVFSTATDGQTSVD
INVFQGEREFVRDNRYLHSFHLDDILLASHGVPQIEVKFCINSNGILSVTAVDKGTGKKQ
GITIINLPNDYEMQRMVNEAERFAKDYKEKRDAIDTKNQAEFVVYQIENQLKELGETRLK
DLQPHSLMVLPLGFPEEYFNKIIGWLYVFSSINIFLFESYYKVDKD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaatgatggtccagtgacgggtccgttgtctgatgcgcattttatgcttgag
gagatttgtgctttgaatttagaaatcaggtggtcaaagatcatcccaagaaatactact
ttgccaacctccaagtcagaggtgttctccacagccacagatgggcagactagtgttgat
attaatgttttccaaggagagagagaattcgttagggacaacagatatcttcacagcttc
catttggatgatatcctacttgcatctcatggggttcctcaaattgaagtgaagttttgc
attaattctaatggtattctttcggtcactgcggttgacaagggcacagggaagaagcaa
ggcattaccattataaatttgcccaatgattatgagatgcaaaggatggtcaatgaagca
gagaggtttgcaaaggattacaaggagaagagagatgccattgacacaaagaaccaagct
gaatttgttgtctaccagatagagaatcagctaaaggaactcggagagacaaggctgaaa
gatcttcagccacattcccttatggttcttcctcttgggttccctgaggaatatttcaac
aagattattggatggctgtacgtgttttcatctatcaatatcttcctctttgaatcgtat
tacaaggttgataaagattaa

DBGET integrated database retrieval system