KEGG   Quercus suber (cork oak): 111993359Help
Entry
111993359         CDS       T05868                                 

Definition
(RefSeq) beta-amyrin synthase-like
  KO
K15813  beta-amyrin synthase [EC:5.4.99.39]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00909  Sesquiterpenoid and triterpenoid biosynthesis
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111993359
Enzymes [BR:qsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     111993359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase
Motif
Other DBs
NCBI-GeneID: 111993359
NCBI-ProteinID: XP_023880968
Position
Unknown
AA seq 762 aa AA seqDB search
MWKLKIAEGGNDPYIFSTNNFVGRQIWEFDPEAGSPEERAEVEEARQNFYKNRYQIKPSG
DLLWRMQFLRERNFKQTITPIKIEDGQEITYENATTALKRAVHFYSALQASDGHWPAENA
GPLFYLPPLVFCMYITGHLNTVFPAEYKKEILRYIYYHQNEDGGLGLHIEGHSTMFCTAL
NYICMRMLGEGPDGGQDNACVRVQKWILDHGGVTHIPSWGKTWLSILGLFEWTGSNPMPP
EFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYNEPYNEINW
KSVRHLCAQEDIYHPHPLIQDLLWDSLYIFTEPLLTRWPFNKLVREKALQVTMKHIHYED
ENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGIKMHSFGSQEWDT
GFAIQALLASNLVDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQDHG
WQVSDCTAEGLKCCLLFSMMPPEIVGEQMEPERFYDSVNVLLSLQSKNGGLAAWEPAGAS
DWLELLNPTEFFADIVIEHEYVECTASTIQALVLFNKLYPKHREDEIENFIKNGVRYLED
IQMPDGSWYGCWGVCFTYGSWFALGGLAAVGKTYNNCLTMRKGVDFLLKIQRDNGGWGES
YLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEDGDFP
QQEITGAFNKNCMLHYAAYRNIYPLWALAEYRKHVPLPSRIT
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagctcaagatagctgagggtggcaatgacccttacatcttcagcacaaacaac
tttgttggaaggcagatatgggaatttgaccctgaggctggtagtccagaagaacgagct
gaggttgaagaggctcgtcaaaatttctacaagaaccgctaccagatcaagcccagtggc
gatctactttggcgaatgcagtttttgagggagagaaatttcaaacaaacaatcactcca
attaagattgaggatgggcaagaaatcacatatgaaaatgccacaactgcattgaagagg
gctgtccatttctattcagccttgcaagctagtgatggtcattggccagctgaaaatgct
ggcccattgttctaccttccacccttggtattttgtatgtatattactggacatcttaat
actgtatttcctgctgagtataaaaaagaaatccttcgatacatatattaccatcagaat
gaagatggtggtttgggacttcacatagagggccatagcaccatgttttgcacagctctc
aactatatttgtatgcgtatgcttggggaaggacctgatggaggtcaggacaatgcttgt
gtaagagtgcaaaaatggatccttgatcatggtggagtaacacacataccttcttgggga
aagacatggctttcgatacttggtctgtttgaatggactggaagcaatccaatgccccca
gaattttggatccttccttcattccttcccatgcatccagccaaaatgtggtgctactgc
cggatggtgtacatgcccatgtcatacttatatgggaaaaggtttgttggcccaatcaca
cctctcattcttcaattgagggaggaactctacaatgaaccttataatgaaattaattgg
aagagtgtgcgtcatctatgtgcacaggaggatatctaccatccccaccctctgatacaa
gatttgctttgggatagtctgtacatattcactgagcctcttctcactcgttggccattt
aacaagttggtcagagagaaggctcttcaagtaacaatgaagcacattcattatgaagat
gagaatagtcgatacattactattggatgtgtggaaaaggttctatgtatgcttgcttgt
tgggttgaagatccaaatggagattatttcaagaagcatcttgctaggatcccagattac
atatgggttgctgaagatggaataaagatgcacagttttggtagtcaagagtgggatact
ggttttgccattcaagcattacttgctagtaatcttgttgatgaaattggacctactctc
gcaaggggacatgacttcataaagaaatctcaggtcaaagacaatccttctggggacttc
aaaagcatgtaccgtcacatttccaaaggatcatggaccttctctgatcaagatcatgga
tggcaagtttctgattgcactgcagaaggtttgaagtgctgcttgcttttctccatgatg
ccaccagaaattgttggtgagcaaatggaaccagagcggttctatgattctgtcaacgtc
ctactttctctacagagtaaaaatggtggtttagccgcatgggagccagcaggagcatca
gattggttggaactgcttaatccaactgaattcttcgctgatattgttattgagcatgag
tatgttgaatgcaccgcatcaacaatccaagctttagttttgtttaacaaattataccca
aagcatagggaggacgagattgaaaacttcattaaaaatggtgtacgctaccttgaagac
atacaaatgccagatggttcatggtatggatgttggggagtttgcttcacttatggttcg
tggtttgcacttggaggtctggctgctgttggcaagacttacaacaattgtctcactatg
cgcaaaggagttgactttctactcaaaatacagagagataatggtggctggggagagagc
tatctttcttgcccaaagaaggaatatgtacctttggaaggaaacagatcaaatttggtc
caaactgcatgggcaatgatgggtcttattcatgctggacaagccgaaagagacccaaca
cctcttcaccgtgcggcaaagctgataatcaattctcaaatggaagatggtgattttcct
caacaggaaatcactggagccttcaataagaactgcatgttacactatgcagcatacaga
aatatatatccgttgtgggctctcgctgaataccgcaagcatgtcccattgccatctaga
atcacttga

DBGET integrated database retrieval system