KEGG   Quercus suber (cork oak): 111994303Help
Entry
111994303         CDS       T05868                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00350  Tyrosine metabolism
qsu00360  Phenylalanine metabolism
qsu00380  Tryptophan metabolism
qsu00950  Isoquinoline alkaloid biosynthesis
qsu00965  Betalain biosynthesis
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111994303
   00360 Phenylalanine metabolism
    111994303
   00380 Tryptophan metabolism
    111994303
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    111994303
   00950 Isoquinoline alkaloid biosynthesis
    111994303
   00965 Betalain biosynthesis
    111994303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:qsu04147]
    111994303
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     111994303
    4.1.1.105  L-tryptophan decarboxylase
     111994303
Exosome [BR:qsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111994303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase DUF1148 Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 111994303
NCBI-ProteinID: XP_023881933
Position
Unknown
AA seq 520 aa AA seqDB search
MGSVKSDHMPSHTSSYNNNPLDPEEFRRQGHMIIDFLADYYRDVEKYPVLSQVEPGYLRK
CLPESTPNKPEPIETILQDVQEHIVPGLTHWQSPNFFAYFQCTSSIAGFLGETLSTGFNV
VGFNWVASPAATELETIVVDWLGEMLELPKSFLFSGNGGGVLQGTTCEAVLCTIVAARDQ
MLSQIGRESLLKLVVYASDQTHSAIQKAAQIAGIHPMNFRAIKTSKSTSYALSPDSLRAQ
ICEDVEAGLVPLFLCATVGTTPTAAIDPLESLCAVAKDYGMWVHVDAAYAGSACICPEFR
HFIDGVEGANSFSLNAHKWFLTTLDCCCLWVKDPSALIKSLSTYPEYLRNKATDSKQVVD
YKDWQITLSRRFRSLKLWFVLRSYGVANLRSFMRNHVKMANLFEGLVAMDKRFEIVVPIN
FAMVCFRILPSALSETVYKNGKLDIVSEEHANEANRKLLESINMSGCVFMTHAVVEGVYV
IRFAVGATLVEERHVITAWKVVQEHANVILSTYKPRALLV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgtcaagtctgaccatatgcccagccacacttcttcttataacaataaccca
ttagaccccgaggaattcaggcggcaaggccatatgatcatagacttccttgctgattat
tatcgcgatgtagaaaaatacccggttctaagccaagttgaaccaggatatctccgaaaa
tgcttgccagagtccaccccaaataaaccagaacccattgaaaccattcttcaggatgta
caggagcacatagttcctggtttaacacattggcaaagccctaacttctttgcttacttc
caatgcactagtagcattgcagggtttctaggcgagacgcttagcaccggcttcaatgtg
gtcggattcaattgggttgcatcaccagcagctactgaactagagacaatagtcgtggat
tggcttggagagatgcttgagctgccaaagtctttccttttctctggcaatggcgggggt
gtgctacaagggactacttgtgaggccgttttgtgcacaattgtcgctgcaagggatcaa
atgttaagccaaattgggagagagagcctcttaaagttggtggtttatgcttctgaccag
acacatagtgcaatccaaaaagcagcacaaatagcagggatccatccaatgaatttcaga
gccatcaagacttctaagtcaacatcatatgcactatcacctgactcactacgagcacaa
atttgcgaagatgtagaagcgggcctagtcccattgtttttatgtgccactgtgggaaca
actccaacggctgccattgatccactagaatcgttatgtgctgtggcaaaagattatgga
atgtgggttcatgttgatgctgcttatgccggaagcgcctgtatttgtcctgagtttcgg
cacttcatcgatggtgttgagggtgcaaactcatttagtctcaacgcacacaagtggttc
ttaaccactttggattgttgttgcctttgggtaaaagatcctagtgccttgataaagtca
ctctcaacctaccctgagtacttgaggaataaagccacggattcaaagcaagtggtggac
tataaagactggcagataaccctaagccgaagatttcgttccttgaaattatggtttgtg
cttagaagctatggtgtagctaaccttaggagcttcatgagaaaccatgtgaaaatggcc
aacctttttgaagggcttgtagctatggataaaaggtttgaaatcgtggtacctataaat
tttgccatggtttgtttcaggattttgccatcggcactaagtgagacagtatacaaaaat
ggtaagcttgacatagtaagcgaggaacatgcgaatgaggcaaaccgcaaattgttggag
tccatcaacatgtcgggctgtgtcttcatgactcatgctgtggtcgagggagtatacgtg
atacgatttgccgttggtgcaactctagttgaggaacgacacgttatcacggcttggaaa
gtggtgcaggagcatgcaaatgtcatactaagcacttataaaccacgagctcttcttgtg
taa

DBGET integrated database retrieval system