KEGG   Quercus suber (cork oak): 111994633Help
Entry
111994633         CDS       T05868                                 

Definition
(RefSeq) beta-glucosidase 11-like isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00460  Cyanoamino acid metabolism
qsu00500  Starch and sucrose metabolism
qsu00940  Phenylpropanoid biosynthesis
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111994633
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    111994633
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    111994633
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     111994633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 111994633
NCBI-ProteinID: XP_023882289
Position
Unknown
AA seq 513 aa AA seqDB search
MLSFSHVFLFLLINISVVEVLGFDKFSRDDFPPDFVFGSGTSAYQVEGAANEDGRGPSIW
DSFSHSGKMHGGNGDIACDQYHKYKDDVQLMVDTGLEAYRFSISWSRLIPNGRGPVNPKG
LQYYNNLINELSSNGIQPHVTLHHSDFPQALEDKYGGWLSREMVKDFTAYADVCFRNFGD
RVLHWTTMNEANVFVIAGYESGVTPPEHCSPPFGINCTRGNSSTEPYLATHHILLAHASA
ARLYKEKYQDQQHGFIGINLLAFWILPLTNKTEDVIAAQRAMDFLIGCRYAYPLVYGDYP
DVMKKNLGSRLPAFTNFESNLVKGSFDFLGLNYYAMLYIKDDSSKLNMEVRDFNADMAIE
LTAIPNDISVNKFSTAPWGLQELLEYFKQAYGNPPIYIHENGHQTPHNSSLEDEPRVNYL
HGHIGALLDALRNGSNTRGYFQWSFLDLFELLGGFESSFGLYYVDVDDPDLKRQPKLSAQ
WYSHFLKTKGAGSDGFIKLEKNLTEFSHAHFSR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtttctctcatgtctttctatttcttctgataaacatatcagtggttgaagta
ctggggtttgataaatttagcagagatgacttcccacctgactttgtgtttggttctggg
acctcagcttatcaggttgaaggtgcagcaaatgaagatgggagggggcctagcatatgg
gattctttttcccattctgggaaaatgcatggaggcaatggggacatagcatgtgatcag
tatcacaaatacaaggatgatgtccagctcatggtggacacaggtttagaggcctacaga
ttttctatctcatggtcaagacttattccaaatggaagaggacctgtcaatccaaagggt
ctacaatattacaacaatcttatcaacgaactatccagcaatggaatccaacctcatgtt
acattacatcacagtgatttcccacaggcactggaagacaagtatggaggatggcttagt
cgagaaatggtgaaagacttcacggcatatgcagatgtctgcttcaggaattttggtgac
agggttttacattggactactatgaacgaggccaatgtgttcgtaatagcgggttatgaa
tcaggagttacgccacctgaacattgttctcctccatttggcattaattgcaccagaggc
aactcctcaactgagccatacttggcaactcatcatatcttgttagcgcatgcatcagct
gctagattatataaggaaaagtaccaggaccagcagcatggatttataggaatcaatctc
ttagctttctggattcttcctctaacaaacaaaactgaagatgtgatcgccgctcaaaga
gccatggacttcctgattggttgcaggtatgcatatcccttggtttatggagactatccc
gacgtaatgaaaaaaaatttaggctcaagacttccagccttcaccaattttgaatcaaat
ctggttaagggttcatttgactttctaggattaaattactatgccatgttgtacatcaag
gatgactccagcaaactaaacatggaggtcagagactttaatgcagatatggcgatagag
ttgacagctattccaaatgatatatcagtaaataagttttcgactgcgccatggggtttg
caagaactgctggagtatttcaagcaagcttacggaaatcctcctatttacattcatgag
aatggacatcaaacaccacacaattcatcattggaagatgagccaagggtgaactacttg
catggacatattggggctttgcttgatgcactgaggaatggatcaaatacgagaggctat
tttcaatggtccttcttggatttatttgagttattgggcggctttgaatcaagctttggc
ctttactatgtagacgtggatgacccggatttaaaaaggcaaccaaagctttctgctcaa
tggtactcccatttcttgaagactaaaggtgccggctcagatgggtttatcaaacttgag
aagaatttgactgaattttcccatgctcacttctctcggtag

DBGET integrated database retrieval system