KEGG   Quercus suber (cork oak): 111995897Help
Entry
111995897         CDS       T05868                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00450  Selenocompound metabolism
qsu00970  Aminoacyl-tRNA biosynthesis
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111995897
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111995897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:qsu01007]
    111995897
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:qsu03016]
    111995897
Enzymes [BR:qsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111995897
Amino acid related enzymes [BR:qsu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111995897
Transfer RNA biogenesis [BR:qsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111995897
 Prokaryotic type
   Other AARSs
    111995897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 OppC_N
Motif
Other DBs
NCBI-GeneID: 111995897
NCBI-ProteinID: XP_023883610
Position
Unknown
AA seq 605 aa AA seqDB search
MAETSQQPPPILPAPGKRNILVTSALPYVNNVPHLGNIIGSVLSADVFARYCRGRGVRTL
YIGGTDEYGTTTEVRALEEGCTPRDLCDKYHNVHAEIYKWFNISFDIFGRTTTKLQTEIT
QQIFTKLNQNGFLKERMTTQLYCENHHSFLADRFVEGECPSCGYPDARGDQCDLCGRLLD
SLDLKNPRCKVDGATPVNRDTKHTFLELDKLQPAVDKFYREATQDGRWSSNSKAITAAWL
KDGLLPRSITRDMKWGTPVPLPGYEEKVIYSWFDACIGYVSITAQYTDQWEQWWRNPEEV
QLNQFIGKDNVVYHSVIFPASQIGTKEPWTMLHHLSTTDYLTYEGGKFSKSRGIGVFGDA
ARETGVPADVWRFYLLAHRPETGDAEFTWDSFVSSNNSVLLNNLGNFVSRVVKFVNSRHY
DNIVPEWEAYQDPVFESWKEEINFMLQQYIRELDTVKIRAGLATVLRISQQGNAFLQSNR
LDSSLREKDALKCAAVIGLSINLFHLLASIIAPYMPDVAKSINMQLRADPLPILDSWSAL
SIQPGHEIGNATHLFTRINPQKAQEWREMFGSAEAKKPKAEETTVKVKKRAPANMAKDSK
SVTKK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacttcgcaacaaccgccgcccattcttccagcacctggaaaacgcaatatt
ctagtgaccagtgctctgccgtacgtcaacaatgtaccacaccttggcaatatcatcggc
tcagtattatctgccgacgtgtttgcacggtactgcaggggtcgtggggttcgcactctg
tatattggcgggacggatgagtatgggaccacgaccgaagtacgtgcgcttgaagaaggt
tgtactcctcgagacctctgtgacaaataccacaacgttcatgcagagatatacaagtgg
ttcaacatcagcttcgatatctttggccgcacgaccacaaagctgcagacagagatcacc
caacaaatattcacaaaactcaatcagaacggttttcttaaagagcggatgactactcag
ctctactgcgaaaatcatcattcgtttctcgctgatcgtttcgtcgaaggcgaatgcccc
tcatgtgggtatccagatgcccgcggagatcagtgcgacttatgcggcagattgctggat
tcgcttgatttgaagaatcctcgatgcaaggtcgatggggctacgcctgtgaacagggac
actaagcacactttcctggagctagacaaattacagcccgcagttgacaagttctaccga
gaagctacccaagatggtagatggtcaagcaacagcaaggcaatcactgcggcttggctg
aaagacggtcttttgccacggagtatcaccagagacatgaaatggggaactccagtccct
ctaccaggatacgaggagaaagtcatatactcctggttcgacgcatgtatcggttatgtg
tcaatcacagcacagtacactgatcaatgggagcagtggtggcgtaaccctgaagaagtt
caactaaaccagttcatcggaaaggataacgtcgtataccattccgtcattttcccagcc
tcacagattggtactaaagagccatggaccatgctgcatcacctctcgacaacggattac
cttacctacgaaggtgggaagttctcaaagtctcgaggtatcggtgtgtttggagatgct
gctcgagagactggtgtgccagctgatgtctggcgcttctacttactcgcccatcgaccg
gagactggcgacgccgagttcacctgggactctttcgtaagcagcaacaacagcgtgctg
ctcaacaatctcggtaattttgtcagtcgtgtagtgaagtttgtgaactcacggcactat
gataacattgtgcctgagtgggaagcttatcaagaccccgtcttcgaaagctggaaagaa
gaaatcaattttatgctccagcaatatattcgtgagctcgacaccgtcaaaatacgcgcc
ggtctcgccacggtactccgcatttctcaacaaggtaacgcattccttcagtccaataga
ctggatagcagtctccgcgagaaagatgccttgaaatgtgccgcggtcatcggcctatcg
atcaacctgttccatctcctcgcttctattatcgcgccgtacatgccagatgtagcgaag
tccatcaacatgcagctacgtgcggatcctctgccaattctggatagctggagtgctcta
tccatccaacccgggcacgagatcggtaatgcaacacatctattcactcggatcaatcca
cagaaggcacaagagtggcgagaaatgtttggaagtgcagaagcaaagaagccgaaagcc
gaagagactaccgtgaaggtgaagaaacgagcgccggcgaatatggcaaaggactcaaag
tcagtgaccaagaagtga

DBGET integrated database retrieval system