KEGG   Quercus suber (cork oak): 111995934Help
Entry
111995934         CDS       T05868                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00564  Glycerophospholipid metabolism
qsu00565  Ether lipid metabolism
qsu00590  Arachidonic acid metabolism
qsu00591  Linoleic acid metabolism
qsu00592  alpha-Linolenic acid metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111995934
   00565 Ether lipid metabolism
    111995934
   00590 Arachidonic acid metabolism
    111995934
   00591 Linoleic acid metabolism
    111995934
   00592 alpha-Linolenic acid metabolism
    111995934
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111995934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 111995934
NCBI-ProteinID: XP_023883648
Position
Unknown
AA seq 822 aa AA seqDB search
MELKRGGKRVVKASGTWRRVADSIGCRTERILAEAMRPIATVLCPALGTVHSFRRSETLE
QNEYERQIHEQQHAPSTASTITSADDRSSELDKMGVEDHGSEKKGLFKGKVSGFYHNVIK
PAFPEAIQDIKLMKGMSALESRVKREISDPKIFPEVEHVANVRRGLDLCPEEQAFLAKRK
VHIRDNFTRYMGLNPEDVHPDDVPIISFGGSGGGFRAMIGCLGYCEQMKQAGLWDCMTYV
SGVSGSCWSLAAYYTIGHGNMQAVIDHCKKRFSPYHPLSGDAIRTILSAPGGARVTLGPL
IQKSKSGLATVAMDLYSVFTTGWIFFEDDPADHPGGHASKEVAGYQRSWYRWSAAREFLD
NGSEPLPIITAIRHERPWKDWSDPEHPFNDADHADGDHADAVDAWFQWYEMTPYEVGCDE
IEAWVPTWGFGRPFEEGKSIMQLPEQSLALLLGLATSAPAGPLTSYISTISRNLPTGFLG
NAIESMAAKVTKLWGKQGTEEFQQHHPLHACNEHNFMFHYSPKQEGEPRPAGLENSPRIH
LIDSGMDNNCPTYVLLHPERQVDVIINMDASSDVQKDTFQERVDQIGGRRGMRFVKRHNV
QPGENEKDPDRFDGMYAQVYDGKPCEKPATVTDSYGRTVTNPPAPLYERECTMIYMPLLP
NEKAVPDFDPSTAKFSGSYNLVWTPEQVETLVKVCVQNFEDGQDTIKEALHEAWQRRKAE
RMHKEQKAAAGQAPSPKIVPHVVPTEDDALHGHLPAPETSFHDPKVQSQGVQPSLPTSAP
IWSEMHRVPEGLADDLTGTNGNAPEEHVQTHTLVLGQPQQKS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaagagaggtggaaaaagagtggtgaaggcctccggcacatggcgccgggtg
gcggattcgattggctgcaggaccgagcgcatcctcgcagaagcaatgcgacctattgct
actgtattatgtcccgcactaggtactgtgcacagctttcgtcggtccgagactctggag
cagaatgagtacgagagacaaatccatgaacagcagcacgccccgtcgaccgcgtctacc
attacctctgcagacgatcgctcttcggaactcgacaagatgggtgtcgaggaccacgga
tcggagaagaaaggcctattcaagggcaaggtcagcggcttctaccataatgttatcaag
ccggcttttccagaagccatccaggatatcaagctcatgaaaggtatgtcagctttggag
tctcgagtcaagcgggaaatcagcgaccccaaaatctttcccgaggtcgaacatgttgcg
aatgtacgacgtggcctggatctttgcccggaagagcaggcattcctcgcgaagcgcaaa
gtccacatacgtgacaactttacgaggtacatgggtctcaatccagaggatgttcacccc
gatgatgtgccaatcatttccttcggaggcagtggcggtgggtttcgtgccatgatcgga
tgtctgggttattgcgagcagatgaaacaggctggtctttgggattgtatgacttatgtc
tcaggtgtgtccggctcctgctggtctctcgccgcgtactacactatcggccacggtaat
atgcaagccgtgattgaccattgcaagaagcgattctcgccttatcatcccttgtccggg
gacgctattcgcaccatcttgagcgctccgggcggagcacgcgtgacactcggacccctg
attcagaagagcaaaagtggtcttgccacggtggccatggatctctactcagtcttcacg
actggttggattttcttcgaggatgatccggcggatcaccctggtggtcatgcgagcaaa
gaagttgctggctatcaacgatcttggtataggtggtctgcagcgcgcgaattccttgat
aatggttcagagcctctgccaatcattacagctattcgtcatgaacgtccgtggaaagat
tggtcggatccggagcatccattcaacgacgcagatcacgcggacggtgatcatgctgat
gctgttgatgcatggttccaatggtatgagatgacaccatacgaagtagggtgcgacgag
attgaagcgtgggtcccaacctggggctttggtcgcccctttgaagagggcaaatcgata
atgcagctaccagagcagtcgctggccttgctcctcgggctagctacaagcgccccggca
ggtccgttgacttcatatatctcgaccatcagtcgtaatctaccgactggcttcctcgga
aatgcgattgagtctatggcagccaaagtcaccaagttatggggcaagcaaggtacggag
gaatttcagcaacatcatccattacatgcatgcaatgagcacaatttcatgtttcactac
tctcccaaacaagaaggcgagccacgtcctgctgggcttgagaactcgccccggattcat
ctcattgactcaggcatggacaataactgtccgacttatgttctcttacatcctgagcga
caagtagacgtgatcatcaacatggacgcgtccagcgatgtacagaaagacacctttcaa
gaacgagtcgatcaaattggtggtcgccgaggaatgcggtttgtgaaacggcataatgtc
cagcctggggagaatgagaaggatccggaccggttcgacggtatgtatgcgcaggtgtac
gatggcaagccttgcgaaaagccagccaccgtgacggactcatatggccggacggtgact
aacccacccgcacctttgtacgagcgcgagtgtaccatgatctacatgccattgctgccg
aacgaaaaggccgtgccggactttgatccctcgactgccaaattctcaggatcgtacaac
ctcgtctggactcccgagcaggtggaaactttagtgaaggtctgtgtgcagaactttgag
gacggacaggacacgatcaaagaagccttacatgaagcatggcagaggcggaaggccgag
cgaatgcacaaggagcaaaaagccgcggctggacaggccccgtcgcctaaaatcgtgcct
catgttgttccaacagaggatgatgctttgcacgggcatcttcctgcgccagagacctca
tttcacgacccgaaagtccagtctcaaggtgtgcagccgagtctacctacttcagcgcct
atttggagcgaaatgcatcgcgtcccagaaggacttgctgacgacttgacgggtacgaat
ggaaatgcaccagaggaacacgttcagacgcacacgttggtactcggtcaaccgcaacag
aagtcttga

DBGET integrated database retrieval system