KEGG   Quercus suber (cork oak): 111998335Help
Entry
111998335         CDS       T05868                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03040  Spliceosome
qsu04141  Protein processing in endoplasmic reticulum
qsu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111998335
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111998335
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111998335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:qsu01009]
    111998335
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:qsu03041]
    111998335
   03009 Ribosome biogenesis [BR:qsu03009]
    111998335
   03110 Chaperones and folding catalysts [BR:qsu03110]
    111998335
   04131 Membrane trafficking [BR:qsu04131]
    111998335
   03051 Proteasome [BR:qsu03051]
    111998335
   03029 Mitochondrial biogenesis [BR:qsu03029]
    111998335
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:qsu04147]
    111998335
Protein phosphatases and associated proteins [BR:qsu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111998335
Spliceosome [BR:qsu03041]
 Complex B
  Other components
   Prp19 complex
    111998335
 Complex C
   Prp19-CDC5 complex
    111998335
Ribosome biogenesis [BR:qsu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111998335
Chaperones and folding catalysts [BR:qsu03110]
 Heat shock proteins
  HSP70 / DNAK
   111998335
Membrane trafficking [BR:qsu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111998335
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111998335
Proteasome [BR:qsu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111998335
Mitochondrial biogenesis [BR:qsu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111998335
Exosome [BR:qsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   111998335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA FGGY_C FtsA BcrAD_BadFG Hydantoinase_A PilM_2 DUF5398
Motif
Other DBs
NCBI-GeneID: 111998335
NCBI-ProteinID: XP_023886202
Position
Unknown
AA seq 703 aa AA seqDB search
MASSTSAQIHGLGITPRGYSGKLNLASSKAFFFGQKLHKTTAFYPKLRAKRVGPLRVVNE
KVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYAKNGDMLVGQIAKRQAVVNP
ENTFFSVKRFIGRKMTEVDEESKQVSYRVVRDENGNVKLDCPAIGKQFAAEEISAQVLRK
LTEDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFE
KKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWLAASFKRD
EGIDLLKDKQALQRLTETAEKAKMELSTLTQTSISLPFITATADGPKHIETTITRAKFEE
LCSDLLDRLKTPVENSLRDAKLSFKDIDEVILVGGSTRIPAVQELVKKLTGKDPNVTVNP
DEVVALGAAVQAGVLSGDVSDIVLLDVSPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFS
TAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVT
AADKGTGKKQDITITGASTLPSDEVQRMVNEAEKFAKDDKEKRDAIDTKNQADSVVYQTE
KQLKELGDKVPAPVKEKVEAKLGELKEAISGGSTQAIKDAIAALNQEVMQLGQSLYNQPG
APGAGPGAGAGPGPAPGGESGSSESSGKGPEGDVIDADFTDSK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcaacctctgcccaaatccatggcctcggaatcacccctcgtgggtattcc
gggaagctcaatttggcttcttccaaagcgttcttcttcggacagaagcttcacaaaacg
acggcgttttacccgaagctgagagcgaagagggtgggacctttgagagtggtgaacgag
aaagtggttgggatcgatttggggacgacgaattcggcggttgcggcgatggaaggtggg
aagccgacgatagtgacgaacgccgaggggcagagaacgacgccgtctgtggtggcgtat
gcgaaaaatggtgatatgttggtgggtcagattgcgaaacgacaggccgttgtgaacccg
gagaacacgttcttttcggtgaagaggtttatcgggaggaagatgacggaggtggatgag
gagagcaagcaggtttcgtatagagttgtgagagatgagaatggaaatgtgaagttggat
tgtccggcgattgggaagcagtttgcggctgaggagatttctgctcaggttttgagaaag
cttacggaagatgcttcaaagtttttgaatgacaaagttacaaaagctgttgttactgtg
cctgcttacttcaatgattcccaaaggacagcaacaaaggatgctggtagaattgctggt
ttagaagtacttcgaatcattaatgaacctactgctgcatctttagcatatgggtttgaa
aagaagaacaacgagaccatcttggtatttgaccttggtggtggtacttttgatgtgtca
gtgcttgaggttggtgatggagtttttgaggttctttccacttctggagatactcatttg
ggtggtgatgactttgacaagagaattgttgattggcttgctgcaagcttcaagagagat
gaaggaattgatctgttgaaggacaaacaagctcttcagcgattaacagagacagctgag
aaagctaaaatggagctttcaactctaacccagacaagcattagtttgccttttattact
gccactgcagatggccccaagcacattgagaccaccatcactagggccaagtttgaagaa
ttgtgttctgaccttctggacaggcttaaaacaccagttgaaaattccttgagggatgca
aaactttccttcaaagatatagatgaggtaatccttgttgggggatcaacacgtatcccg
gctgttcaggagcttgtgaagaagttgactggaaaggaccccaatgtgacagttaatcct
gatgaagttgttgcccttggggctgcagttcaggctggtgttttgtctggggatgtcagt
gatatcgtgcttttggatgtttcaccattgtcactaggtcttgaaaccctaggtggtgta
atgacaaagatcatcccaagaaatactactttgccaacctccaagtcagaggtgttctcc
acagccgcagatgggcagactagtgttgagattaatgttctccaaggggagagagaattc
gtcagggacaacaaatctcttggcagcttccgtttggatggtatcccacctgcacctcgt
ggggttcctcaaattgaagtgaagtttgacattgatgcgaatggtattctttcggtcact
gcggctgacaagggcacaggaaagaagcaagacattaccattaccggtgctagcacattg
cccagtgatgaggtgcaaaggatggttaatgaagcagagaagtttgcaaaggatgacaag
gagaagagagatgccattgacacaaagaaccaagctgattctgttgtctaccagacagag
aaacagcttaaggaactgggagacaaggttcctgccccagtgaaagagaaggtggaggcc
aagcttggagagctcaaggaagcaatttctgggggttcaacacaagccatcaaggatgcc
attgcagccctcaatcaagaagtcatgcaactaggtcagtccctttacaaccaaccaggt
gctcctggtgctgggcctggtgctggtgcagggcctggacctgcacctggcggtgaatct
gggtcttcagaatcatcaggcaaggggcctgaaggagatgttatagatgcagatttcacc
gacagcaagtga

DBGET integrated database retrieval system