KEGG   Quercus suber (cork oak): 111999790
Entry
111999790         CDS       T05868                                 

Definition
(RefSeq) nitrite reductase [NAD(P)H]-like
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00910  Nitrogen metabolism
qsu01100  Metabolic pathways
Module
qsu_M00531  Assimilatory nitrate reduction, nitrate => ammonia
qsu_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    111999790
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     111999790
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Pyr_redox Fer2_BFD Rieske NIR_SIR_ferr Rubredoxin_C Pyr_redox_3 NAD_binding_9 Amino_oxidase 2-Hacid_dh_C Tsp45I
Other DBs
NCBI-GeneID: 111999790
NCBI-ProteinID: XP_023887671
Position
Unknown
AA seq 1113 aa
MSNSEWNDPEANVLPDKVEKLVEMDEIPKTTKRKRVVVVGLGMVGVAFIEKLMKLDVKRR
EYDVIVIGEEAHLAYNRVGLTSFFQHREVENLYLNPASWYASMPEGSLNYHLNSLVTSID
TEKKSVETSQGQTVPYDILVLATGSDALLPRHTPGHDANGVFVYRTIDDLQKLIAFSATK
TGTVGAVVGGGLLGLEAAKAMMDLEKFEKVKLIERNRWVLSRQLDGDAGTMVVEQVRALG
LDVLLSKRVGKINTDAENNVTGVTFEDGESMDCSCICFAIGIKARDELARQSGINCADRG
GGIIINPDMSTSVPDIYAIGECASWESQTFGLIAPGIEMADILAFNLTQAGSHTPRKFSS
PDLSTKLKLLGVEVASFGDFFADRDGPKSAPVSRRSAKKEVDVEGQDRVRSLTDGPPPPA
VKALTYKDPFQQVYKKYLFTMDGKYLLGGMMIGDTKDYVKLVPMVKKKQALQVPPSEFIV
GTKGDDNGDDLDDDVQVCSCHNVTKGDVSKSVKDGTCKSIGDVKSCTKAGTGCGGCMPLV
QTIFNKTMESMGQEVKNHICPHFDYSRADLFNIIYVKHLETFPDIMRECGKDANSSGCEV
CKPAIGSITASLFNKHVLDKNRRGLQDTNDRYLANIQRNGTYSVVPRVAGGEITADRLIV
LGTVAKKFGLYCKITAGQRVDLFGASKSDLPLIWKDLIDGGMESGLAYAKSLRTIRSCVG
STWCRYGLHDSVGMAIRLEERYKSIRSPHKMKGGVSGCVRECAEAQNKDFGLVATDKGWN
IYVGGNGGATPRHSELLAKDVVTDDVIPILDRYLSFYIRTADRLQRTARWIENLPGGIGY
LREVILEDKLGICAELEKQMQDLVGSFFCEWTEALKRPDILKNFTQFANTEEKVSNIEAV
EDRDQSRPAFWPKDSTTTDFRGTQWSSLTFQPLAQLDQFTDDQAGSSIAVKRGDTQLAIF
KAKGKFYCTQQMCPHKRAFVLSDGLIGDNGNKLWVSCPLHKRNYDLSGEEAGKCSSDDAV
NIATFPVEVREGLVYVKLPPIEELDSVLGTSNFKIKAEGEATPFKEMDKKFDAMKMKGRK
GLNASHLQNGLGSEGKAQSILAGGERGANGMDW
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgagcaatagcgaatggaacgatcccgaggccaatgtcctgccggacaaggtcgagaaa
ctcgtcgagatggacgaaatccccaaaaccaccaagaggaaacgggtggtggtggtcgga
ttggggatggtaggggtcgccttcatagaaaagctgatgaagcttgacgtgaagagaaga
gagtacgatgtgattgtgattggagaagaagcacatttggcatacaatagagttggcttg
acgagcttctttcagcatcgagaagtggagaacctctacttgaacccagcatcgtggtat
gcatccatgcccgaaggatctttgaactaccatttgaactccctcgtcacttcgatcgat
accgagaagaaatccgtggagacctcacaaggtcagaccgtcccatacgatatcctcgtc
cttgcaactggctcggatgcgttattgcccaggcatacgcccggccacgatgcgaacggc
gttttcgtctaccgcaccatcgatgacttgcaaaagttgatcgctttctccgccaccaag
actggaaccgtcggcgcggtagtagggggtggtctgctgggcttagaagctgccaaggct
atgatggacctggagaagtttgaaaaagtcaagctgattgagcgtaacagatgggtgctc
agcaggcaacttgatggcgatgccggtacaatggttgttgaacaagtgcgagccctcggg
ctggacgtgcttctcagcaaacgagtcggcaagatcaataccgatgcggagaacaatgtg
accggcgtcaccttcgaagacggtgaatcgatggattgctcttgcatttgcttcgcgatt
ggcatcaaagcaagagatgagctcgcaagacagtctggtatcaactgcgcggaccgaggt
ggtgggataattatcaacccagacatgtccacatctgttccggacatctacgcaatcgga
gaatgcgccagctgggaaagccaaacgtttggtctgattgcgccaggcatcgagatggca
gacatcctcgccttcaatcttacccaagctgggtcacacacgcctcgcaagttctccagc
ccagacctgagtacaaagttgaaacttctgggagttgaggtagcaagtttcggagacttt
tttgcagatcgggacggacctaaatcagcacctgtatcgcgacgaagtgcgaagaaagag
gtggacgttgaggggcaagatcgtgtgagaagcctcacggatggcccaccccctcctgcc
gtcaaggctcttacctacaaggatcccttccaacaagtttacaagaaatacctgttcacg
atggacggaaagtatcttcttggaggtatgatgatcggagacactaaagactacgtgaaa
ctcgtgcccatggtcaagaagaagcaggccttacaggtcccacccagcgaattcattgtc
ggcaccaagggtgatgataatggggatgatctggacgacgatgtgcaggtgtgttcttgc
cacaacgtcaccaaaggcgacgtctcaaagagtgtcaaggatggaacttgcaagtccatc
ggcgacgtgaagtcctgcaccaaagctggcactggatgcggaggatgcatgccccttgta
caaacgatcttcaacaagaccatggaatcaatgggtcaggaggtcaagaaccatatttgc
ccacactttgactattcacgtgcagatctattcaacatcatatacgtcaagcatctggag
acgttcccggatatcatgagagaatgtggcaaagatgccaattcgtccggttgcgaggtc
tgcaaacctgctattggctccatcaccgcatctctcttcaacaagcacgttctcgacaag
aatcggaggggactgcaagacaccaatgaccgatatctggcgaatatccagcgtaatgga
acgtattcggttgtgccgcgagtcgccggaggagagatcactgcagataggcttatcgtc
ttgggcacggtggcaaagaagtttgggttgtattgcaaaatcactgctggtcaaagagta
gacttgtttggtgccagcaaaagcgatctaccactgatttggaaagacttgatcgatgga
ggaatggagtccggcttggcttacgcgaaaagcttgcgaaccatccgtagctgcgtcgga
tccacatggtgtcgatacggactccacgatagcgtcggtatggcaatacggctggaagag
cgatacaagtcaattagatctccccataagatgaaaggtggagtgtctggatgtgtacga
gaatgtgcagaagcgcagaacaaagatttcggattggtcgccacggacaaagggtggaac
atctacgtcgggggtaacggaggtgctacgcccagacacagcgagctattggcgaaggac
gtagtcaccgacgatgtcatccccattttggacaggtatttgtcgttctacatacgtaca
gcggatcgccttcaacgcactgcgcgctggatcgagaatctaccaggaggcatcgggtat
ctccgcgaggttatccttgaagacaagctgggaatctgtgccgagctcgaaaagcagatg
caggatctcgtcggatcgttcttttgcgagtggactgaagccctgaaacgaccagatatc
ttgaaaaacttcacccagtttgcgaacaccgaggagaaagtcagcaacattgaggcggtg
gaggaccgtgatcagagccgacctgcattctggccaaaggactcgaccactaccgacttc
cgtggcacgcaatggtcgtcgctcactttccagcctctcgcacagctggatcagttcacc
gacgaccaagctgggagcagtattgctgtcaagcgtggagatacccaactggccatcttc
aaagccaaagggaaattttattgcacccaacaaatgtgtccgcacaagagagcgttcgtt
ctttccgatggtctcatcggtgacaacggcaacaaactctgggtcagctgtcctctccac
aagcgcaactacgacttatcgggcgaggaggctggcaaatgtagcagtgatgatgctgtg
aacattgctacatttccggtagaggtgcgagaaggtttggtctacgtgaagctaccgccc
atcgaggagctcgactcggttcttggaacgagcaacttcaagatcaaggcggagggcgaa
gctacgcctttcaaagagatggataaaaaattcgatgcgatgaagatgaagggccgcaag
ggtctcaacgcaagccatctacagaacggtctgggctcggaaggcaaagcgcagtcaatc
cttgctggcggcgagagaggtgccaacggcatggattggtga

DBGET integrated database retrieval system