KEGG   Quercus suber (cork oak): 112000089Help
Entry
112000089         CDS       T05868                                 

Definition
(RefSeq) putative serine/threonine-protein kinase
Organism
qsu  Quercus suber (cork oak)
Brite
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112000089
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112000089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Kinase-like ABC1 APH Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 112000089
NCBI-ProteinID: XP_023887961
Position
Unknown
AA seq 363 aa AA seqDB search
MDHALQALVAATASFFVVTLIFAFLVILCRKPKKPTPTTSTQRPGRAHNPVNNMTELSSV
TDESASFDPNLRISMQELRKATKDFSTDLIIGDGSFGLVYKAQLSSGDTVAIKKLDPDAF
QGFREFRAEMETLGKLRHPNIVKILGWCVSGNDRLLIYEFVQKGSLDQWLQQEQDVPTLS
WGTRVKIVKGVAKGLSFLHNLEKPIVHRDIKASNVLIDSDFEAHIADFGLARRIDTSNSH
VSTQFAGTMGYMPPEYKEGLTAATLEADVYSFGILMFEIATGKRPNLPTLFDGKEVGLVQ
WARKMLAQNQHMEMVDASLSREDGLIEPHVKQYFEIAGMCTSEIRKERPAMAKIVEMLDQ
IPV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctctccaagcactcgttgcagccaccgcaagcttcttcgtagtgaccctg
atcttcgctttcttggtgattctatgtcgaaaacccaagaaacccacacccacaacatcc
acccagcgccctggacgagctcataaccctgtcaataacatgaccgagctatcctcggtc
acagatgagagcgcttccttcgaccctaacctccgaatctccatgcaggagctgaggaag
gccaccaaagatttctccacagacttgatcatcggtgacggcagcttcggcctcgtctac
aaggcacagctctccagcggcgacaccgtcgccataaaaaaactagacccagatgctttc
caaggttttcgtgagtttcgagctgagatggagactttaggtaagcttcgacatccaaac
atagtcaaaattctcggctggtgcgtgtccggcaatgataggcttctcatatacgagttt
gttcagaaaggtagtttggatcagtggttacagcaagagcaggatgtgcccactttatct
tgggggactcgagttaagattgtcaagggtgtggctaaaggactctctttcttgcataat
ttggaaaaacccattgttcatcgagatattaaggccagcaatgtgcttatagactctgat
tttgaggcccatattgctgattttggtctcgcaaggaggatcgacacctcgaattcacat
gtgtccactcaatttgcaggcacaatggggtacatgccccctgagtacaaagaaggcctc
actgcagctactctcgaggctgatgtttacagttttgggatcttaatgtttgaaattgct
actgggaaacgacccaatttgcctaccctttttgatgggaaagaggttgggttagtccaa
tgggcaaggaaaatgctggcccaaaatcagcatatggaaatggtggacgctagtttgtcg
agggaggatggcctaatagaaccccatgtgaaacagtattttgaaattgcaggtatgtgt
actagtgagatacgaaaagaaaggccagctatggctaagattgttgaaatgttagatcaa
attcctgtctga

DBGET integrated database retrieval system