KEGG   Quercus suber (cork oak): 112000244Help
Entry
112000244         CDS       T05868                                 

Definition
(RefSeq) LRR receptor-like serine/threonine-protein kinase EFR
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112000244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRRNT_2 LRR_8 ABC1 APH Kinase-like LRR_4
Motif
Other DBs
NCBI-GeneID: 112000244
NCBI-ProteinID: XP_023888110
Position
Unknown
AA seq 449 aa AA seqDB search
MSPFTLMMLIKRRSILLLLAFLLVQPCILHLSHSSNNFTDQSALIALKSEISFHPNDTVF
SVGNWSTTTDFCEWFGVSCSRRRQRVTALNLSYVGLQGTISPHIGNLSFLVSLDLGNNSF
SGFLPHEIGNLHRLRELRLANNLLEVNWRTISYQELCRGTNNFCESNLLGIGGFGTVYKG
ILSDGTTVAVKVLNLHLEGAFKSFDAECKVLRAFRHRNLVKVINVCSSPKFKALVLQYMS
NYSLEKWLYSHNYCLNLVQRVRIMVDIASALDYLHNGQLESVVHCDLKPSNILLDEDMVA
HVGDFGIAKILAENKDATQTRTIGTIGYIAPEYGSEGRVSTKCDIYSYGIILLEMITRKK
PTDEMFVGELSIRQWIASLPDKMEAVDDGLLRMEDGRDVTVMQTILSSILELGLRCSEEL
PDERLDVKDVVAKVNKIKLALLENRNKGV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccttcacactcatgatgctaattaaaaggcgatccattctcttgctcttggct
tttctgttagtgcagccatgcatacttcacttgtcccactcttccaacaactttacagat
caatcagctctcattgccctcaaatccgaaatcagttttcatccaaatgatactgtcttt
tctgttggtaattggtccacaacaacagacttctgtgagtggtttggggtctcttgcagc
cgacgcagacaaagagtcacagccttgaacctttcctatgtgggtctacaaggcaccatt
tcccctcatattggcaacctctccttcctagtctcacttgaccttggaaacaacagtttc
tctggttttctgccacatgagattggtaatctacaccgtttgagggaacttcggttggca
aacaacctattggaagtgaattggagaacgatatcatatcaagaactttgtcgtgggaca
aataacttttgtgaaagcaacttgcttggaattggagggtttggtacagtgtacaaaggg
atattgtctgatgggactactgttgctgtaaaagttctaaacctgcatttggagggtgct
tttaaaagttttgatgctgaatgcaaggtgttaagggcatttcgacataggaatctagtt
aaagtcattaatgtatgctccagtcccaagtttaaagctctggtgttgcagtacatgtca
aattatagtcttgaaaagtggttatactctcacaactactgcttgaatcttgttcaaaga
gtacgcattatggttgacattgcatcggcgttagattatctccataatggtcaattagaa
tctgtggtgcattgcgatttgaagcctagcaatattcttttggatgaggacatggttgca
catgttggagactttggcattgcaaagattttagctgaaaataaggacgcaacccaaacc
agaaccattggtacaattggctacattgcaccagagtatggttctgaagggagagtatcc
accaaatgtgacatttatagttatgggataatattgttggagatgatcacaagaaagaaa
cctaccgatgaaatgtttgttggagaactaagtataaggcaatggattgcatcacttcct
gacaaaatggaagccgtggacgatggtttgcttaggatggaagatggaagagatgtgact
gtcatgcaaactatcctttcatctatcctagaattaggcttgaggtgctctgaagaatta
ccggatgaaagacttgacgtcaaggatgtggtggccaaggttaacaaaatcaaattggca
ctacttgaaaacagaaataagggtgtttga

DBGET integrated database retrieval system