KEGG   Quercus suber (cork oak): 112002238Help
Entry
112002238         CDS       T05868                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00020  Citrate cycle (TCA cycle)
qsu00640  Propanoate metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01200  Carbon metabolism
Module
qsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
qsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112002238
   00640 Propanoate metabolism
    112002238
Enzymes [BR:qsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     112002238
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     112002238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 112002238
NCBI-ProteinID: XP_023890161
Position
Unknown
AA seq 332 aa AA seqDB search
MGRQAFVKIIGSISKASSSSWTQTRQYAAAAAHPSPAVFVDKNTRVICQGITGKNGTFHT
EQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAATAILEA
MEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHK
PGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGI
VLIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI
KTLREAGVTVVESPAKIGVTMHDVFKQKGLVS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgccaagccttcgtcaagataatcggctcgatctctaaagcttcttcttcttca
tggactcagactcggcaatacgccgccgctgctgcgcatccttcgccggcagttttcgtg
gacaagaacactcgtgtcatctgccaaggcatcaccggaaagaacggcaccttccacacc
gaacaagccatcgaatacggcaccaaaatggtgggtggtgtaacgccaaagaagggtgga
acagaacacttgggacttcctgtcttcaacacagttgcagaagcaaaggctgaaacaaag
gccaatgcctctgtcatttatgttcccccaccttttgctgctacagctattctggaggcg
atggaagctgagttggatcttgttgtgtgcatcacagaggggatccctcagcatgatatg
gtacgggtgaaggctgctcttaacaggcaatcgaaaactcggttgattgggccaaactgc
cctggaattatcaagcctggagaatgtaaaattggaattatgccagggtacatccacaaa
cctggtcgtgtaggaattgtttcgcgatctggtaccttaacctatgaagctgtgttccaa
actacagctgttggccttggacaatctacttgtgtgggtatagggggggatccttttaat
gggacaaactttgttgattgcattgaaaagtttctagtggatccacagacagaaggtatc
gttcttattggagagattggtgggactgcagaggaggatgctgctgcacttataaaggaa
agtgggactgagaagcctattgttgcatttattgctggtctaactgccccccccggccgt
cgtatgggtcatgctggagctattgtgtcaggtgggaagggcacggcccaagataagatc
aagacccttagagaagctggggttacagtggtagagtctcctgcaaagattggtgttacc
atgcatgatgtttttaagcagaagggccttgtgagttag

DBGET integrated database retrieval system