KEGG   Quercus suber (cork oak): 112002606Help
Entry
112002606         CDS       T05868                                 

Definition
(RefSeq) probable methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00450  Selenocompound metabolism
qsu00970  Aminoacyl-tRNA biosynthesis
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    112002606
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    112002606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:qsu01007]
    112002606
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:qsu03016]
    112002606
Enzymes [BR:qsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     112002606
Amino acid related enzymes [BR:qsu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   112002606
Transfer RNA biogenesis [BR:qsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    112002606
 Prokaryotic type
   Other AARSs
    112002606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 112002606
NCBI-ProteinID: XP_023890526
Position
Unknown
AA seq 615 aa AA seqDB search
MRTRPPLATVSLTPLQCLIARRWRPSWICQNGQTDRVKWLRSIVTSTNHGKPYYITTPIF
YVNAAPHVGHMYTMILTDVLKRWQELKGRRAILCTGTDEHGMKIQQAAAKADVPPKEFCD
RGAEVFKDLAERIDVSHDIFIRTTDLKHKAGVEYAWQMLHDRGYIYESKHEGWYSVSDET
FYPQSQVHLVVDPPTGRKMMASIETGKEVEWTSERNYHFRLSAFRQRLLDFYQQNPDFIV
PRSRMSEVVRQVTAPLEDLSVSRPVDRLSWGIRVPTDDSQTIYVWLDALLNYATAAGYPF
MPGAEMSGGWPADVQVIGKDIVRFHCIYWPAFLMALDLPLPKQILTHAHWTLGKQKMAKS
TGNVVNPFFALERFGTDVMRWYLVHNGGIADDADYENSYIIDKYKKGLQGGLGGLTSRVM
RSKNWSVPNAVKRFALPERNHDHSHPPPWMDGADKRSWTEYASLQTLPVRVDAQMTALHP
NKAAEVIIHSIHGTNSFISAMSPWLVVTKLRSAMADTTGQEMYEAEKAGQSIEQMELEIE
RTIYLSAEALRLSGIMLQPFMPTAAKRLLDMLGVAEDRRTWEWCSEGKDSSYGVPMVPLG
KGDQGALFPPLISEY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccaggccgcctcttgcaactgtgagtctgacaccgctccagtgtctcatcgcg
cgcagatggagaccgtcatggatatgtcagaacggccagactgaccgtgtaaaatggtta
cggtccatcgtgacctccaccaaccatgggaaaccgtactacataactacacccatcttc
tacgtcaacgccgcgcctcatgtcggccacatgtacaccatgatcctaacggatgttctg
aagcgatggcaagagctcaaaggtcgacgtgccatactctgtaccggtaccgacgaacat
gggatgaaaatacaacaagccgctgcgaaagcggatgttccgcccaaagagttttgcgat
agaggtgctgaggtcttcaaggatctggcggagcggattgatgttagccatgacattttc
atacgaaccacagatctgaaacataaggccggggtggaatatgcatggcaaatgcttcac
gaccgcggttatatctatgagagcaaacacgagggatggtatagtgtctcagacgagacg
ttctacccacaaagtcaagtacatttggttgtcgaccccccgacaggacgtaagatgatg
gcgagcattgagacggggaaagaagtcgagtggacgagcgagaggaattatcattttcgc
ttgagtgctttccggcaaagactcctagatttctatcagcagaacccagatttcattgtc
ccacgatcgcgcatgagcgaagtggtgcgacaagtaactgcacctttagaagatctctct
gtctcccggcctgtagatcgtctctcctgggggatccgcgtaccaaccgatgactctcag
accatatatgtttggttggatgctctgttgaattatgcgaccgctgctggttacccattc
atgcccggggccgagatgtcaggcggctggcccgccgatgtgcaagttattggcaaagat
attgttcgtttccattgcatctactggcccgcttttctcatggcacttgacctccccctc
ccgaaacagattttgacacatgcgcactggacactgggaaaacaaaaaatggccaaaagc
acgggaaacgtagtcaatcctttctttgccttggaacgtttcgggaccgatgtcatgcgt
tggtacttggttcacaacggcggcattgccgatgatgccgactatgagaatagctacatc
atcgacaaatacaagaaaggactgcaaggaggactcggaggacttaccagcagagtcatg
cgaagcaagaactggagtgtcccgaatgccgtcaaacgttttgcactaccagaacgcaat
catgaccatagtcatccgccaccctggatggatggcgcggacaaacgatcgtggaccgag
tatgccagcctccaaactttaccagtgcgtgtagatgcgcagatgacagctctccaccca
aacaaagctgccgaagtcatcattcatagtattcacggcaccaactcattcatttctgcg
atgtcgccctggctggtggtcacgaagctccgctctgccatggctgataccacgggccag
gagatgtatgaagctgagaaggctggacagtccatagaacagatggaactcgagatcgag
cgcaccatctatctcagtgcagaagctctgcgcttatctggtattatgctgcagccgttc
atgccaaccgcggcgaaacgtttgctagacatgctgggtgtggcggaggataggcgcaca
tgggagtggtgcagcgagggcaaggatagctcatacggcgttcccatggtgcctcttgga
aaaggagaccagggcgcattattcccgcctctgatcagcgagtactaa

DBGET integrated database retrieval system