KEGG   Quercus suber (cork oak): 112002749Help
Entry
112002749         CDS       T05868                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase B-like
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:qsu03110]
    112002749
Enzymes [BR:qsu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     112002749
Chaperones and folding catalysts [BR:qsu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    112002749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 112002749
NCBI-ProteinID: XP_023890670
Position
Unknown
AA seq 208 aa AA seqDB search
MASFQRIIISILLIATFSFLYFAQSGEAAVGPKITHKVYFDIQHGDEDIGRIVMGLYGKT
TPKTAENFRALATGEKGFGYEGSTFHRVIKQFMIQGGDFTKGDGTGGKSIYGEKFQDENF
KLKHSKKGLLSMANSGKDTNGSQFFITTVITSWLDGRHVVFGEVLEGFDVVEKIENVPKG
AGDKPSKTIKIAKSGELEVPAEGIRAEL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctttcaacgaattatcatcagcatcctgctgatcgccacattttcctttctg
tactttgcccagagcggcgaggccgcggttggtccaaagatcacccacaaagtgtacttt
gacattcagcatggcgacgaagatatcggccgcattgtgatgggtctttacggcaagact
accccaaagaccgccgagaactttcgtgccctcgctaccggcgagaagggctttggatat
gagggatcgaccttccaccgtgtcatcaagcaattcatgatccagggaggagacttcacc
aagggcgacggcactggcggcaagagcatttacggcgagaaatttcaggacgagaacttc
aagctcaagcacagcaagaaaggactattgagcatggccaactctggcaaagacaccaat
ggctcccagttcttcatcacgaccgtcatcacctcgtggcttgacggacgacatgttgtc
tttggtgaagtcttggaaggctttgatgtcgtcgagaagatcgagaacgtacccaaaggc
gccggcgataagcccagcaagacgatcaagattgcgaaatcaggcgagcttgaggtgccg
gcagaaggtattagagcggaactctaa

DBGET integrated database retrieval system