KEGG   Quercus suber (cork oak): 112002765Help
Entry
112002765         CDS       T05868                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112002765
Enzymes [BR:qsu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     112002765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 112002765
NCBI-ProteinID: XP_023890684
Position
Unknown
AA seq 189 aa AA seqDB search
MTVKAYFDVSWTGPKLTADANGNVTNVDKSDQPRTGRINFELYDDVVPKTVENFRALCTG
EKGFGYSGSKFHRVIPEFMLQGGDFTRGNGTGGKSIYGEKFADENFQLKHNKPFLLSMAN
AGPNTNGSQFFVTTVVTSWLDGRHVVFGGVPTGDTESISVIKSVEACGSSSGAIKNKSAP
PTITGAGAS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcaaggcctacttcgatgtctcctggaccgggcctaaactcaccgccgatgct
aatggcaatgtcaccaacgtcgacaagagcgaccagccccgcacgggccgcatcaacttc
gagctgtacgacgatgtcgttcccaagacagttgagaacttccgtgccctctgcaccggc
gagaagggcttcggctactctggtagcaagttccaccgtgtgattcccgagttcatgctt
cagggtggagacttcacccgcggtaacggcaccggtggcaagtccatctacggcgagaag
ttcgccgacgagaacttccagctcaagcacaacaagcccttcctcctctccatggccaat
gccggccccaacaccaacggctctcagtttttcgtcaccaccgttgtcacctcgtggctc
gacggccgccacgtcgtcttcggcggtgtcccgaccggcgataccgagtccatcagcgtc
atcaagagcgtggaggcttgcggcagcagcagcggcgccatcaagaacaagtccgcccca
ccaactattaccggtgccggtgcttcgtaa

DBGET integrated database retrieval system