KEGG   Quercus suber (cork oak): 112005928Help
Entry
112005928         CDS       T05868                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 3-like
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:qsu03016]
    112005928
Enzymes [BR:qsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     112005928
Transfer RNA biogenesis [BR:qsu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    112005928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 112005928
NCBI-ProteinID: XP_023893998
Position
Unknown
AA seq 151 aa AA seqDB search
MASVFEAKKKRILQQLDVPDVDYQDASPKGSVDINIRGLVADINSQDGFVTTSSCGGRVA
VYCEGSVKANAGGKGGGNWLFTSHEQVDTSTSNHAGELFRLIGLPVEVAVSVPIAVTSAS
FIHFKFEPMVRIVHSSNVQYSQHLPVEGFQT
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgtctttgaagccaagaaaaagcggattttgcagcagctcgatgtgcctgat
gtggattaccaagacgcttctcccaaaggctccgttgatatcaacattcgaggattggtt
gctgacatcaacagtcaagacggtttcgtcacaacaagcagttgcggggggcgtgtagca
gtctattgtgaaggatcggtgaaagcgaatgctggcgggaaaggtggcggtaactggctc
ttcacatcacacgagcaggtcgatacgagtacttccaatcatgctggcgagctattcagg
ttgatcggtttacctgtagaggttgcagtctcagtaccgatcgctgttactagtgctagc
ttcattcatttcaaattcgagccaatggtaaggattgtccattcttcgaacgtacaatac
agccaacacctaccagttgaggggttccagacatag

DBGET integrated database retrieval system