KEGG   Quercus suber (cork oak): 112006134Help
Entry
112006134         CDS       T05868                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 2-like isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00350  Tyrosine metabolism
qsu00360  Phenylalanine metabolism
qsu00380  Tryptophan metabolism
qsu00950  Isoquinoline alkaloid biosynthesis
qsu00965  Betalain biosynthesis
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    112006134
   00360 Phenylalanine metabolism
    112006134
   00380 Tryptophan metabolism
    112006134
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    112006134
   00950 Isoquinoline alkaloid biosynthesis
    112006134
   00965 Betalain biosynthesis
    112006134
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    112006134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:qsu04147]
    112006134
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     112006134
    4.1.1.105  L-tryptophan decarboxylase
     112006134
Exosome [BR:qsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112006134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 112006134
NCBI-ProteinID: XP_023894202
Position
Unknown
AA seq 517 aa AA seqDB search
MGSLTFDNDHENNSHFVTNPLDPKEFRRQGHLIIDFIADYYENIERYQVLSQVEPNYLRS
LLPESAPFSPESIETILQDVQKYIIPGITHWQSPNYFAYFPSSGSTAGFLGEMLSTGFNV
VGFNWMSSPAATELECIVMDWLGEMLKLPKSFLFSGNGGGVLQGTTCEAILCTLTAARDQ
MLRQVGREKMEKLVVYGSDQTHSAIQKAAKISGISPINFRAVKTTKSTSFGLCPKSLRDA
VQADVQAGLVPFFLCATVGTTSTNAIDPIGPLCEVAKDYSIWVHVDAAYAGSACICPEFR
HFIDGIEGANSFTLNAHKWFFTTLDCCCLWVKDPSTLIESLSTNPSYLRNKATDSKQVVD
YKDWQITLSRKFRAMKLWLVLRSYGVANLRCILRSHVKMAKLFEELVRLDNRFEVVAPRN
FALVCFRVLPKPNVKKVYENGVANHDEKALDLERVNELNQKLLDSINRSGHVYMSPTVVD
GVYIIRCAIGATLTEERHVIMAWKVVQEHADALLSRY
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcctcactttcgataatgatcatgaaaacaattcccacttcgtcactaaccct
ctagacccaaaggaatttaggaggcaaggccacctgatcatagacttcattgcagattat
tatgaaaatatagagagatatcaagtcctaagccaagttgagccaaattatcttcgaagt
ctcttaccagaatctgcccctttctctcctgaatccattgaaaccatcctccaagatgtg
cagaaatatattatacctgggatcacacactggcagagtcctaactactttgcgtacttc
ccttcaagtggtagcactgctggttttcttggagaaatgcttagcactggctttaatgta
gtgggattcaattggatgtcatcacctgctgcaactgaactagagtgtattgtcatggat
tggcttggtgaaatgcttaaactaccaaagtctttcctcttttctggcaatggtggaggt
gtattgcaagggactacttgtgaggccattttgtgtacattaactgcagcgagggatcaa
atgctaagacaggttggaagagagaagatggaaaagttggtggtttatgggtctgaccaa
acgcatagtgcgatacaaaaggcagccaaaatttctggaatcagcccaataaatttccga
gctgtcaagacaacaaagtcaacctcttttgggttatgcccaaagtctctacgtgatgca
gttcaagcagatgttcaagctggactagtcccattctttctttgcgccacagttgggaca
acttcaacaaatgccattgatccaatagggccattatgcgaagtagccaaagattatagc
atatgggtccatgttgatgccgcatatgctggaagtgcttgcatttgcccagagtttcgg
catttcattgatggcattgagggtgcaaattcattcactttgaatgcacataagtggttc
tttactactttggattgttgctgcctttgggtgaaggatccaagcaccttgatagaatca
ctctcaacaaatccttcgtatttaagaaataaggccactgattcaaagcaagtggtggac
tacaaagactggcaaataaccttgagtcgaaaattccgagccatgaaattgtggcttgtg
ctcagaagctacggcgtggcaaacctcaggtgcattttaagaagccatgttaaaatggct
aagctttttgaagaacttgtaaggcttgataataggtttgaggttgtggcccctagaaat
tttgctttggtctgctttagggttttgcctaagccaaatgttaaaaaagtttatgagaat
ggtgtggctaaccatgatgagaaggccttagatttggaacgtgtaaatgagctaaaccag
aagctgttggactcaatcaataggtcaggccatgtctacatgagtcctactgtggttgat
ggagtatacataattcggtgtgctataggtgcgaccctgacagaggaacgacatgtgatc
atggcttggaaggttgttcaagaacatgcagatgctttgctcagcagatattga

DBGET integrated database retrieval system