KEGG   Quercus suber (cork oak): 112007616Help
Entry
112007616         CDS       T05868                                 

Definition
(RefSeq) wall-associated receptor kinase-like 8
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112007616
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112007616
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112007616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind WAK PIP49_C Haspin_kinase Toxin_38
Motif
Other DBs
NCBI-GeneID: 112007616
NCBI-ProteinID: XP_023895757
Position
Unknown
AA seq 688 aa AA seqDB search
MAVKFVMRITFLLLLAVAYGLAEGAPPMAKPNCPDRCGNVSIPYPFGIGSNCFMNKTYEI
VCNESGVAAAAIAFLVFPSIRVEVLEIRITDPYNNNDDSFYGPGFIRVKMPIISSNCINK
SSAGSVARVNISGTPFFFSSYRNKFVSVGCDNLATMTGLNPMMVVGCKTNCSNKKLIGKC
SGFDCCQTSVPDGIQLLNVTFSHTSSCQRAFLAETQWLEKTDPSASNHFLNSDYVPVMLE
WIVKFTDYDFEELYYRRHIDWYNTTYGVLYPYCSYGFQGNPYLNMGCQVISPSFGVLFLL
LVIWRLYKVIKKRNKIKLKQKFFKRNGGLLLQQQLSSNENNVQKGKLFNSKELEIATDSF
NENRILGKGGQGTVYKGMLTDGRIVAIKKCNTVDEGNLEQFVNEIIILSQINHRNVVKLL
GCCLETEVPLLVYEFISNGTLFQYLHEENEDFPLLTWDMRLRIATEIAGALSYLHSAASL
PIYHRDIKSSNILIDDKYRAKVADFGTSRSVAIDQTHVTTLVYGTFGYLDPEYFQTSQFT
DKSDVYSFGVVLIELLTGEKPVSSTRSAESRNLSTYFVHSLKENCLFDILDTQVRKVCNK
DEVIAIANLAKRCLHLNGKKRPTMLEIMMELEGVQKVSHVQPNFDELEYVRNEEMGPQND
VSISASSCLELRSTSLSDALPLLSFKSV
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaaatttgtaatgagaattactttcttacttctgctggcagtggcatatgga
ttagcagaaggagcaccacctatggcaaaacccaattgtcctgatagatgtggaaatgtt
tcgattccatatccgtttggaatcggaagcaattgcttcatgaacaagacgtatgaaatt
gtttgcaatgaaagtggagtcgcggctgctgctatagccttcttagtctttcccagcatt
cgcgtggaggtgctggaaatcagaattactgatccttataataataatgatgattctttt
tatgggcccggattcattcgagtcaagatgcctattatttcttcgaactgcataaataag
agttcggcggggagtgttgcacgggtgaacatctccggaaccccatttttcttctcgtca
tatcggaataaattcgtttcggttggttgcgacaacttggccacaatgactggtctgaat
cctatgatggtggttggttgcaagacgaattgcagcaataaaaagttgataggtaaatgc
tcagggttcgactgctgccagacctcagtccctgatgggattcagcttcttaatgttact
ttctcacacacgagtagttgccaacgtgccttcctagcagagacacaatggttagagaaa
acagatccctctgcctctaaccattttctgaattcggattacgttcctgtgatgctggag
tggattgtaaaattcactgactatgattttgaggagttgtattacagacggcatattgat
tggtataatacaacatacggggtcctgtatccttattgcagttatggattccaaggaaat
ccttaccttaacatgggatgtcaagttatttctccaagctttggggtactgtttctactc
cttgttatttggaggttatacaaagtgataaagaaaagaaacaaaatcaagctcaagcaa
aaattcttcaaaaggaatggtggtttgttattacaacaacaattatcttcaaatgaaaac
aacgttcaaaagggaaaattattcaattcaaaggagttggaaattgcaactgatagtttt
aatgaaaatagaatacttggtaagggtggacaaggtacagtttataaaggaatgttaact
gatggaagaattgtggcaattaaaaagtgcaacacagtggatgagggaaatcttgaacaa
ttcgttaatgagattatcattctttcacaaatcaatcatagaaatgtggttaaactactc
gggtgttgtcttgagacagaagttcctttgttagtttatgaattcatttccaatggcaca
ctttttcagtatctccacgaagaaaatgaagattttccattgctaacatgggatatgcgc
ttaagaattgccacagaaattgcgggagctctatcatacttacactctgcagcttcactg
cccatttaccatcgagacattaaatcttcaaacatactcattgatgacaaatatagagca
aaagtagcagattttggcacttcaagatcagtggccattgaccaaactcatgtaacgaca
ctagtatatggtacttttggctacttggatccagaatactttcaaacaagccaatttaca
gacaaaagtgatgtttatagtttcggagtggtccttattgagcttttaacaggagaaaaa
ccagtttcttcgacaagatcagcagaaagtcgaaatctatctacatattttgttcattca
ttaaaagagaactgtctctttgatatacttgatactcaagtacgtaaggtttgtaataaa
gatgaagtcatcgcaattgctaaccttgcaaaaagatgtttgcacttgaatggaaagaaa
cgacctaccatgttagagatcatgatggaattggagggagttcaaaaagtttctcatgtt
caaccaaattttgatgaacttgaatatgttagaaatgaagaaatggggccacagaatgac
gtttcaatttcagcaagttcatgtttagaattacgttcaacttcattatcagacgcccta
ccacttttatcctttaaatcagtttga

DBGET integrated database retrieval system