KEGG   Quercus suber (cork oak): 112007946Help
Entry
112007946         CDS       T05868                                 

Definition
(RefSeq) probable glucan 1,3-beta-glucosidase A
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00500  Starch and sucrose metabolism
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    112007946
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     112007946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 112007946
NCBI-ProteinID: XP_023896064
Position
Unknown
AA seq 477 aa AA seqDB search
MRPHALPALVFGLSAAGQAAAQMRGVNIGGWLVTEEWMTPSLYNNTFAADEWHLCGELGK
DQCASTFQEHWSSFYTREDFVDIANAGLNTVRIPIGYWAVDLLDYEPYVSGQYPYLIQAV
QWAKELNLSVMISLHGAPGSQNGAETSGLIGPVLFATNQSNIDRTFNVLKNFTTEFSRDV
YGGAVTSIELLNEPGLFTLDFSMAQLQDFYTKGVTLIHGINSTMNVIIADAFYGAAWWAN
YNPVPDTPLVYTILDAHQFYAFPPLNALDEDGAITRICAQSALLKQNISDSGIPPTIIGE
WSLQSGVSTSTNNSEGLTQERRTWFRLFFEAQIAAYTSNGPGQSAGGWIFWAWKTEGDIA
TWSYRRGITSKWIPADVSDPNQLAYPILASGCVDSNHSYSAPAYVPPFNPDVWSHASTNS
AGDTAGTTTASGTSGPKKSGGSSSTDAKGAASSTRSPLGLSQLCLLAFCIALGMIWL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctcatgccttgcctgccctggtcttcgggctcagcgcggccggacaggccgcg
gcgcagatgcgcggcgtaaatattggagggtggttggtcacggaggagtggatgaccccg
tcgctctacaataacactttcgctgcggacgagtggcatttgtgtggtgaactgggcaaa
gatcaatgtgcatcaacgttccaggagcactggagctcattctacacccgcgaggacttt
gtcgatatcgcaaatgctggacttaacaccgtgagaatacccatcggttactgggccgtg
gacctactcgattatgaaccctatgtctccgggcaatatccctacctcatccaagcagtg
caatgggccaaagaactcaacctctcggtcatgattagcttgcacggcgcgccgggttcg
caaaacggagcggagacctctggactcatcggccctgtgctgttcgcgaccaaccaatcc
aacatcgaccggaccttcaacgtgctgaagaacttcaccacggaattctcgcgagacgtc
tatggtggcgccgtcactagcatcgagttgctcaacgagccaggactgttcaccctcgac
ttctcgatggctcagctgcaggatttctataccaaaggtgtaactctgatccacggcata
aactccaccatgaacgtcatcattgctgatgccttttatggcgccgcctggtgggctaac
tacaatcctgtgcccgacacaccattggtctacaccattttggacgcgcatcaattctat
gctttcccgccattgaacgccctggacgaagatggggccatcacgcgtatctgcgcccaa
tccgcgcttctcaaacaaaacatctccgacagcggtattccgccgaccatcatcggagaa
tggagtctccaaagtggtgtctcgacgtccaccaacaattccgagggcctgactcaagag
cgtcgcacgtggttccggctcttctttgaagcgcaaatcgccgcgtacacctcgaacggt
ccggggcaaagtgctggtgggtggatcttctgggcgtggaagaccgagggcgacatcgcg
acttggtcctatcgccggggcatcacgtcgaagtggatccccgccgacgtctccgatccg
aaccaattagcctacccgatcctcgcgagcggctgtgtggactccaatcacagttattcg
gcgccagcatacgttcccccgttcaacccggatgtgtggtcccacgcgtcaacgaactcg
gccggggacacggctggaacgacgacggcgagtgggacgagtggcccgaagaagtccgga
ggcagttcatctacagacgcgaaaggggcagcgtcctcgaccaggagccccctgggtctg
tcgcaactgtgcttgctcgcattctgcatcgcattgggtatgatttggttataa

DBGET integrated database retrieval system