KEGG   Quercus suber (cork oak): 112009536Help
Entry
112009536         CDS       T05868                                 

Definition
(RefSeq) dihydroxyacetone synthase-like
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu01100  Metabolic pathways
qsu01200  Carbon metabolism
Module
qsu_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
Enzymes [BR:qsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     112009536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr E1_dh Transketolase_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 112009536
NCBI-ProteinID: XP_023897637
Position
Unknown
AA seq 741 aa AA seqDB search
MPPSAVAVHQDDIDHLPLKFAGKDDGANATALVEDVRMDSSDKTDHVLKAYRCFIAELCQ
QFNMGHPGSAMGMAAIGIALWKYTMKYSPKNPNFFNRDRFVLSNGHACLFQYTFLHLVGY
EQMTFDQLVSYHSDRWDSLTPGHPEIEHDGIEVTTGPLGQGIANAVGLAMASRHLGATYN
RDGFDMVNNMTWCTIGDACLQEGVAMEAFQLAAHWRLNNLCVLYDNNQITCDGSVDMCCS
EDVNAKMRAVGFDVLEVEDGNYDVEAVVKALVEARASQDKPTFINIKTTIGEGSRKAGTA
GTHGAPLGQDDVDFIKEKYGLENARPLEISKDVYDFFREAIPRGQQLEKDWNSTLEQYSS
AHPELAAEFKKRMAGEMVADWTKLIPTKEEFPTSPTPSRKSAGFVMNPLAEKVKNFMVGT
ADLTPSVNMAWKNKVDFQHPNLKTACGLNGDYTGRYIHWGIREHAMASMSNGLAAFNKGT
IIPVTSSFFMFYIYAAPGVRMGALQSLQVIHIATHDSIGTGEDGPTHQPIELAALYRAMP
NFLYIRPCDSEEAAGAMIAAVRATDSPSMISVARQDTPQYPQHSSRAGVQQGAYVFIDEA
HPDVTLLGVGAEMVFAVAARDALARRGIVARIVSFPCQRLFEQQPREYRRAVLGSVPRVV
IEAYAVNGWERYADAGYSMHSFGHSLPRDYIYQRFNFTAEKIAQKVAGVVEDARRDGLES
FRGDFRDLNVDYVKDVFAHGR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgccaccttcagccgtcgccgtccatcaggacgatattgatcaccttccattgaagttt
gcagggaaggacgatggcgccaacgccacagcgctcgtcgaagacgtgcgaatggactcg
tccgacaagacagatcatgtcctcaaagcgtatagatgtttcatcgcagagttatgtcaa
cagttcaacatgggacatccgggttctgccatgggtatggcagcgatcggcattgctcta
tggaaatataccatgaagtactcccccaagaacccgaatttcttcaaccgagatcggttt
gttctgtccaacgggcacgcatgtctgttccagtacacttttctccacctcgtcggatac
gagcaaatgactttcgatcaattggtgagctaccactccgatcgatgggattcactcact
cctggccacccggagatcgaacacgatgggatcgaggtcacgactggaccactcggtcaa
ggaattgccaatgccgtcggtcttgctatggcatcgagacacctcggagccacttacaat
cgtgacggattcgacatggtcaacaacatgacttggtgcactattggcgatgcgtgcttg
caggaaggtgtggccatggaagctttccagctcgctgctcactggagattgaacaacctc
tgtgtcctgtacgacaacaatcaaatcacttgtgacggatctgtcgacatgtgctgttca
gaagacgtcaacgccaagatgcgcgctgttggtttcgacgtgctggaggtcgaagatggc
aactacgatgtggaagcggttgtcaaagcgctcgtcgaggcgcgtgcttcccaggacaaa
ccgacgttcatcaacatcaagaccactattggagagggcagcagaaaggccggtacagct
ggcacccacggtgcacctctcggtcaagacgatgttgatttcatcaaggagaaatacggt
cttgaaaatgctcgtcctcttgaaatcagtaaagatgtctacgacttcttccgcgaagca
attcctcgcgggcagcagctggagaaggactggaacagcacacttgaacaatatagctca
gcacacccagaacttgctgcagagttcaagaagcgtatggctggcgagatggtagcggac
tggacgaagctaattccaacgaaagaagaattcccaacatcgccaactccatctcgcaag
tcagctggttttgtgatgaaccctctcgcagaaaaagtgaaaaatttcatggtcgggact
gcagacctcacgccttctgtgaacatggcatggaagaacaaggtcgatttccaacacccc
aatctcaagaccgcttgcggccttaacggcgactacaccggccgctacatccactggggc
atccgcgaacatgccatggcatccatgtccaacggtttagcggctttcaataaaggcacc
atcatacccgtcacttcgtccttcttcatgttctacatttacgccgcacctggcgtgcgc
atgggcgccctccagagcctgcaagtcatccacatcgccacgcacgactccatcggcaca
ggcgaggacggtccgacgcaccagcccatcgagctcgcggccctctaccgcgccatgccc
aattttctgtatatccgaccgtgcgacagcgaagaagccgcgggagctatgatcgccgcg
gtccgcgcgaccgactcgccatccatgatctccgtcgcccgccaagacaccccgcagtac
ccacaacactcgtcgcgcgctggcgttcagcaaggcgcgtacgtcttcatcgatgaagcg
cacccggacgtcacgctactcggcgtcggcgccgagatggtcttcgccgtcgctgcgcgt
gacgcgctcgccaggcgcggcatcgtcgcccgcatcgtctcgtttccctgccagcggctg
ttcgagcagcagccgcgcgagtaccgtcgagccgtgctcggcagcgtccctcgcgtggtc
atcgaagcgtacgcggtcaacggctgggagcgctacgcggacgccgggtactcgatgcat
tccttcgggcactcgctgccgcgagactacatttaccagcgctttaatttcacggcggag
aagatcgcgcagaaggtcgccggcgtcgtggaggatgcgcgccgggacgggctggagagt
ttccgcggcgacttccgggatctgaacgtcgattatgtgaaggacgtcttcgctcacggt
cggtga

DBGET integrated database retrieval system