KEGG   Quercus suber (cork oak): 112012085Help
Entry
112012085         CDS       T05868                                 

Definition
(RefSeq) cell division control protein 2 homolog A
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112012085
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:qsu03032]
    112012085
   03036 Chromosome and associated proteins [BR:qsu03036]
    112012085
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112012085
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112012085
DNA replication proteins [BR:qsu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112012085
Chromosome and associated proteins [BR:qsu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112012085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo APH Choline_kinase Fructosamin_kin
Motif
Other DBs
NCBI-GeneID: 112012085
NCBI-ProteinID: XP_023900215
Position
Unknown
AA seq 294 aa AA seqDB search
MEQYEKVEKIGEGTYGVVYKARDRVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQH
GNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFAKDLRQVKMFLYQILRGIAYCHS
HRVLHRDLKPQNLLIDRSTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRH
YSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNDDTWPGVTSLPDYKSA
FPKWPPKDLAAVVPSLDSAGIDLLTKMLCYDPSRRITARSALEHEYFKDIGFVP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtatgagaaagttgagaagattggagaaggaacatacggcgtggtttataag
gctcgtgaccgggtgactaatgagactatcgctttgaagaagattcggctggagcaggaa
gacgagggagtaccaagcaccgcaatacgcgaaatctccctcttgaaagaaatgcagcat
ggcaacattgtcaggttacaagatgtggtgcacagtgagaagcgcttgtatctggttttt
gagtaccttgacttggatctgaagaagcacatggattcatctccagaatttgcaaaggat
ctacgtcaagtaaaaatgttcctttatcaaattctacgtggcattgcttattgtcattcc
catagagttcttcatcgagatttgaaaccccagaatttgctcatagatcgcagcaccaat
gcactgaagcttgctgactttggactggccagagcatttggtattcctgtcaggacattt
acacacgaggtggtgacactgtggtacagagctccagaaatattgcttggatcccgccat
tactctacccctgttgatgtgtggtcggtaggttgtatatttgctgagatggttaaccaa
cggccattatttcctggggactctgagattgatgagctgtttaaaattttcagggtcttg
ggtactccaaatgatgatacgtggcctggtgtgacttctttgcctgattataaatctgcc
tttcccaaatggcctcctaaggatctggcagctgtggttccaagtcttgattcagctgga
attgatcttcttacaaaaatgctctgctatgaccccagcagaagaattacagccaggagt
gctcttgagcatgaatacttcaaagatatcggatttgtaccctga

DBGET integrated database retrieval system