KEGG   Quercus suber (cork oak): 112012502Help
Entry
112012502         CDS       T05868                                 

Definition
(RefSeq) probable chlorophyll(ide) b reductase NYC1, chloroplastic
  KO
K13606  chlorophyll(ide) b reductase [EC:1.1.1.294]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00860  Porphyrin and chlorophyll metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    112012502
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.294  chlorophyll(ide) b reductase
     112012502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 112012502
NCBI-ProteinID: XP_023900644
Position
Unknown
AA seq 289 aa AA seqDB search
CEGGDSQMNTLIWYSWLGGIIIGTMVGANMVLDEHCRAGPRNVVITGSTRGLGKALAREF
LLSGDRVVVASRSPESVHMTVKELEENLKDFITTASGSARKNLQHAKVVGIACDVSEPDD
VQKLANFAVNELGSINIWINNAGTNKGFRPLLQFSDEDVKQIVSTNMVGSLLCTREAMRV
MKNQAKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKESKRSKVGVHTASPG
MVLTDLLLSGSTIQNKQMFNIICEHPETVARTLVPRMRVVKGSGKAINY
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
tgtgaaggtggagatagtcagatgaacactttgatctggtatagctggcttggaggaatt
attattggaacaatggtaggtgctaatatggtgttagatgaacattgtcgagctggtcca
cgcaatgttgtcattactggaagtacaaggggattgggaaaagcgcttgctcgtgaattt
cttctttctggagatcgtgtggttgttgcttctcgcagccctgagtctgtacatatgact
gtcaaagagcttgaagagaacctaaaggattttataaccactgcaagtggctcagccagg
aaaaatctgcaacatgcaaaagtggtaggcatagcatgtgatgttagtgaaccagatgat
gtgcagaaattggcaaactttgctgtcaatgagcttggttctatcaacatttggataaat
aatgctggcacaaataaaggttttagaccattgctgcaattctctgatgaagatgttaaa
cagattgtctcaacaaacatggttggttctctactctgcactcgagaagccatgcgagtg
atgaagaaccaggctaaggggggccacatatttaacatggatggtgcaggctcaggggga
tctagtacccctctaacagctgtctatgggtccacaaagtgtggccttaggcagcttcaa
gcatcactcttgaaagagtccaagcggtccaaagttggggtgcacacagcatctccaggc
atggtccttacagatcttttgcttagtggctcaactatacaaaataagcaaatgtttaac
atcatctgtgagcatccagaaacagttgctagaactttagtaccaaggatgcgggttgta
aaaggatctgggaaggcaatcaattac

DBGET integrated database retrieval system