KEGG   Quercus suber (cork oak): 112013331Help
Entry
112013331         CDS       T05868                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase cmkA-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112013331
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     112013331
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   112013331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg TetR_C_27 Stn1
Motif
Other DBs
NCBI-GeneID: 112013331
NCBI-ProteinID: XP_023901494
Position
Unknown
AA seq 482 aa AA seqDB search
MDQLDAVSVRNTLWRVKSSSGQDAGLATFGLGGIDAVLDPHRKTTAARFSPVFHYLTYDA
IPLIAHPTPTCTQADDSPLPVTNMLNKLHGQPESYDRKSKYRMGRTLGAGTYGIVKEADS
PEGKVAVKIILKKNVKGNDQMVYDELEMLQKMRHPHIVRFVDWFESRDKYYIITQLATGG
ELFDRICEKGKFTEKDASATMRQVLDAVNYLHENDVVHRDLKPENLLYLTRAEDSDLVLA
DFGIAKHLDSPDGVLKTMAGSFGYAAPEVMLKRGHSKPVDMWSLGVITYTLLCGYSPFRS
ESLADLIDETKNEKVIFHDRYWKDVSEQAKKFIRALLRADPHARLTSKEALGDPWIAGIG
ATDHNLLPEIKAYMARCRLKRGVDLVKLANRIEALRMQEDDEDEAPGDADIPLDSSRAAK
EAQTAHSSAAGLQVPAQEPGRKRSLSKVAKSAIFREVVLAKVREMKAEEEQKRTISEATG
KH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacttgatgctgtgagcgtgcgcaacaccctgtggcgcgtcaagtcaagcagt
gggcaagatgcaggactcgcgacgttcggtctcggtggaattgatgcagttctcgatccc
caccgcaagaccaccgctgcacgcttcagccccgtcttccactacctcacctacgacgct
atccccctgatcgcacatcctactcctacttgcacccaggctgacgattctccgctccca
gtcaccaacatgttgaacaagctgcatggccagccggaaagctatgatcggaagagcaaa
taccgcatgggccgcaccctcggcgcaggcacctatggcatcgtcaaggaagctgacagc
cccgagggcaaggtcgccgtgaagatcatcctcaagaagaacgtcaagggcaacgatcag
atggtgtacgacgagctcgagatgctgcagaagatgcgacacccccacatcgtccgcttc
gtcgattggttcgagtcacgggacaaatactacatcatcacacaactcgccaccggcggc
gagctgttcgaccggatctgcgagaagggcaagttcaccgaaaaggacgcgagcgcgacg
atgcggcaggtcctcgacgccgtcaattacctgcacgagaacgacgtggtgcaccgggat
ctcaagccggagaacctgctgtacctgacccgcgccgaggattcggacctcgtgctcgcg
gacttcggcatcgccaagcatctcgacagcccggacggcgtgctcaagaccatggcgggc
tccttcggctatgccgcccccgaggtcatgctcaaacgcggccatagcaagcccgtcgac
atgtggtccctgggcgtcatcacctacaccctgctgtgcggctactcccccttccgctcc
gagtcgctggccgacctgatcgacgagacgaagaacgagaaggtcatctttcacgatcga
tattggaaggacgtctcggagcaggccaaaaagttcatccgcgccctgctccgtgccgat
ccgcacgcccggctcaccagcaaggaggccctgggcgatccgtggatcgccggcatcggc
gccaccgaccacaacctgctgcccgagatcaaggcgtacatggcgcgctgccggctaaaa
cgcggcgtcgacctcgtcaagctggcgaaccgcatcgaagccttgcgcatgcaggaggac
gacgaggacgaagcccccggcgacgcggacatcccgctggactcgagtcgcgcggccaag
gaagcgcagaccgcccattcatccgccgccggcctgcaggtccccgcacaggagcccggg
cggaagcgaagtctgtccaaggtggccaagagcgccatcttccgcgaggttgtcctggct
aaggtccgcgagatgaaggcggaagaggagcagaaacgcaccatttccgaagcgacgggc
aagcattga

DBGET integrated database retrieval system