KEGG   Quercus suber (cork oak): 112014729Help
Entry
112014729         CDS       T05868                                 

Definition
(RefSeq) putative fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00010  Glycolysis / Gluconeogenesis
qsu00030  Pentose phosphate pathway
qsu00051  Fructose and mannose metabolism
qsu00710  Carbon fixation in photosynthetic organisms
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01200  Carbon metabolism
qsu01230  Biosynthesis of amino acids
Module
qsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
qsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
qsu_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
qsu_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112014729
   00030 Pentose phosphate pathway
    112014729
   00051 Fructose and mannose metabolism
    112014729
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    112014729
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     112014729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 112014729
NCBI-ProteinID: XP_023902888
Position
Unknown
AA seq 294 aa AA seqDB search
MPLQKLANNRAVQMLNAAAEGRYGVLGVVSYNMETIVASIRAAEVKRAPIQILLFPWALN
YSPLLVDLAANAARKASVPVTVHMDHAQDPEVIRHASTILAGDGTPAFDSIMVDMSHYEK
AENLSRTKELVALCHSRGIATEAEPGRIEGGEDGVKDTAELEGMMTTAEEVDEFVDTGID
FLAPAFGNVHGDYHGVENIKLDYERLASIHDKTKGNVQVVLHGTNEFTPEIMAKCVERGV
TRVNVNKLVLSKYNKYVADNTGKIPLTQLMEQGTALIQELCEQWMDHLGCSGKA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcctctacaaaagcttgccaataatcgagccgtacaaatgctcaatgccgctgcggaa
ggccgctacggtgtgttgggtgtagtgagctacaatatggagaccattgtcgcttcgatt
cgcgcggcagaggtgaagcgtgcgccaatccagatcctgctcttcccatgggcgctcaac
tactccccactcctggtcgatctcgcggccaatgctgcacgcaaggcttctgtgcccgtc
acagtgcatatggatcacgcgcaagatcccgaagtcatcagacatgcgagtactattctc
gcaggagacggcactccagcgttcgacagcatcatggtggacatgagtcactacgagaag
gcggagaacctctcgcggaccaaagagcttgttgcgctctgtcactcacgcggcattgcg
acggaggcggagcctggtcgaatcgagggcggcgaggatggtgtgaaagatactgcggaa
ctggaggggatgatgacaacggccgaggaagtggatgagtttgtcgacacggggattgat
tttttggcgcctgcattcggaaacgtgcacggtgattatcacggggtggagaatatcaag
ctggactacgagaggttagcatcgattcatgacaagacgaaaggcaacgtgcaggtcgtg
ctgcatggcacgaacgagtttacgcccgagatcatggccaaatgcgtggagcgaggagtc
acgagggtcaatgtgaacaagcttgtgctcagcaagtacaacaaatacgttgcggataac
acgggcaaaattccacttacgcagctcatggaacaaggcacagcgttgattcaggagctg
tgcgagcaatggatggatcatctgggctgtagtggaaaagcatag

DBGET integrated database retrieval system