KEGG   Quercus suber (cork oak): 112015817Help
Entry
112015817         CDS       T05868                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112015817
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     112015817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 112015817
NCBI-ProteinID: XP_023904026
Position
Unknown
AA seq 332 aa AA seqDB search
MPICSNWLHLTPNKFYAHNLLIGFTHRHVITPTRSRCFARAVTSESAMAAASNSVRVAAA
QMTSVNDLAVNFATCSSLVKEAVSAGAKLLCLPESFSYVGARDGDSVKIAEPLDGPIMQR
YCSLARESSIWLSLGGFQEKGSDDEHLHNTHVVIDDTGNIRSTYRKIHLFDVDVPGGRVY
KESSFTEAGKDIVAVDSPIGRLGLTVCYDLRFPEIYQQLRFQHDAQVLLVPSAFTKVTGE
AHWEILLRARAIETQCYVIAAAQAGKNNDKRESYGDSLIIDPWGTVVGRLPDRLSTGIAV
ADIDLSLIDSVRAKMPIAKQRKPIEFWKSASL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccaatttgtagtaattggcttcacctcacgccaaacaagttctacgctcacaacctt
ctcattggcttcacccatcgacacgtcatcactcccacacgctcccgctgtttcgcacgt
gcggtcacctccgagtcagccatggccgccgcttctaactcagtccgagtcgccgccgct
cagatgacctccgtcaacgacctcgccgttaactttgccacctgttcgagcctcgtcaaa
gaagcagtgtcggctggggcgaaattactttgcctccccgaatccttctcttatgtaggt
gcaagggatggcgatagtgtcaagattgcagaacctttagatggaccaattatgcaaaga
tactgctctctggcaagagaatccagcatttggttgtcacttggaggcttccaggaaaaa
ggatctgatgatgaacacctgcataacacgcatgttgtgattgatgatactgggaacatt
agaagcacttatcgcaaaatacacttgtttgatgtggatgttcctggcggaagagtatac
aaggaaagtagctttacagaagcagggaaggatattgttgctgtagacagccccatcgga
cgtttgggtctgacagtttgctatgatttaagattcccagagatctaccagcagcttagg
ttccagcatgatgcacaggttctattggtaccttcagctttcactaaagtaactggtgag
gcacattgggagattcttcttcgtgctcgtgcaattgaaacacaatgctatgtcatagct
gccgcacaagctggaaagaacaatgataaaagagaaagctacggtgactccttaattatt
gatccatggggaactgtagttggtcgacttcccgatcgattgtcaactgggattgctgtg
gcagatattgatttgtccttaattgattcagtgagggcaaaaatgccaattgccaagcaa
cggaagcccattgaattctggaaatctgcatctctgtaa

DBGET integrated database retrieval system